Detailed information of TA system TA279876

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 45812..46238
• Replicon: plasmid pAVS0465-A
• Accession: NZ_CP124368
• Organism: Escherichia coli strain AVS0465

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QJP75_RS25690
• Protein ID: WP_001372321.1
• Coordinates: 45812..45937 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	46014..46238 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QJP75_RS25655 (41143)	41143..41847	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
QJP75_RS25660 (41913)	41913..43427	+	1515	Protein_49	Tn3-like element TnAs1 family transposase	-
QJP75_RS25665 (43469)	43469..43636	+	168	Protein_50	relaxase	-
QJP75_RS25670 (43740)	43740..44006	-	267	Protein_51	IS200/IS605-like element IS200C family transposase	-
QJP75_RS25675 (44059)	44059..44763	-	705	WP_001067858.1	IS6-like element IS26 family transposase	-
QJP75_RS25680 (45191)	45191..45364	+	174	Protein_53	hypothetical protein	-
QJP75_RS25685 (45362)	45362..45592	-	231	WP_001426396.1	hypothetical protein	-
QJP75_RS25690 (45812)	45812..45937	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QJP75_RS25695 (45879)	45879..46028	-	150	Protein_56	plasmid maintenance protein Mok	-
- (46014)	46014..46238	-	225	NuclAT_0	-	Antitoxin
- (46014)	46014..46238	-	225	NuclAT_0	-	Antitoxin
- (46014)	46014..46238	-	225	NuclAT_0	-	Antitoxin
- (46014)	46014..46238	-	225	NuclAT_0	-	Antitoxin
QJP75_RS25700 (46050)	46050..46238	+	189	WP_001299721.1	hypothetical protein	-
QJP75_RS25705 (46207)	46207..46969	-	763	Protein_58	plasmid SOS inhibition protein A	-
QJP75_RS25710 (46966)	46966..47400	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
QJP75_RS25715 (47455)	47455..49413	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QJP75_RS25720 (49472)	49472..49705	-	234	WP_000006004.1	DUF905 domain-containing protein	-
QJP75_RS25725 (49761)	49761..50246	-	486	WP_042029316.1	single-stranded DNA-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	qacE / sul1 / mph(A) / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr	-	1..103076	103076

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T279876 WP_001372321.1 NZ_CP124368:c45937-45812 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT279876 NZ_CP124368:c46238-46014 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin