Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5101602..5101823 Replicon chromosome
Accession NZ_CP124367
Organism Escherichia coli strain AVS0465

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP75_RS24970 Protein ID WP_001531632.1
Coordinates 5101602..5101709 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5101757..5101823 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP75_RS24945 (5097446) 5097446..5098528 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP75_RS24950 (5098528) 5098528..5099361 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP75_RS24955 (5099358) 5099358..5099750 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP75_RS24960 (5099754) 5099754..5100563 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP75_RS24965 (5100599) 5100599..5101453 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP75_RS24970 (5101602) 5101602..5101709 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5101759) 5101759..5101822 + 64 NuclAT_12 - -
- (5101759) 5101759..5101822 + 64 NuclAT_12 - -
- (5101759) 5101759..5101822 + 64 NuclAT_12 - -
- (5101759) 5101759..5101822 + 64 NuclAT_12 - -
- (5101759) 5101759..5101822 + 64 NuclAT_13 - -
- (5101759) 5101759..5101822 + 64 NuclAT_13 - -
- (5101759) 5101759..5101822 + 64 NuclAT_13 - -
- (5101759) 5101759..5101822 + 64 NuclAT_13 - -
- (5101759) 5101759..5101822 + 64 NuclAT_14 - -
- (5101759) 5101759..5101822 + 64 NuclAT_14 - -
- (5101759) 5101759..5101822 + 64 NuclAT_14 - -
- (5101759) 5101759..5101822 + 64 NuclAT_14 - -
- (5101759) 5101759..5101822 + 64 NuclAT_15 - -
- (5101759) 5101759..5101822 + 64 NuclAT_15 - -
- (5101759) 5101759..5101822 + 64 NuclAT_15 - -
- (5101759) 5101759..5101822 + 64 NuclAT_15 - -
- (5101759) 5101759..5101822 + 64 NuclAT_16 - -
- (5101759) 5101759..5101822 + 64 NuclAT_16 - -
- (5101759) 5101759..5101822 + 64 NuclAT_16 - -
- (5101759) 5101759..5101822 + 64 NuclAT_16 - -
- (5101759) 5101759..5101822 + 64 NuclAT_17 - -
- (5101759) 5101759..5101822 + 64 NuclAT_17 - -
- (5101759) 5101759..5101822 + 64 NuclAT_17 - -
- (5101759) 5101759..5101822 + 64 NuclAT_17 - -
- (5101757) 5101757..5101823 + 67 NuclAT_10 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_10 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_10 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_10 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_5 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_5 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_5 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_5 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_6 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_6 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_6 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_6 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_7 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_7 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_7 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_7 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_8 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_8 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_8 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_8 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_9 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_9 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_9 - Antitoxin
- (5101757) 5101757..5101823 + 67 NuclAT_9 - Antitoxin
- (5101759) 5101759..5101824 + 66 NuclAT_18 - -
- (5101759) 5101759..5101824 + 66 NuclAT_18 - -
- (5101759) 5101759..5101824 + 66 NuclAT_18 - -
- (5101759) 5101759..5101824 + 66 NuclAT_18 - -
- (5101759) 5101759..5101824 + 66 NuclAT_19 - -
- (5101759) 5101759..5101824 + 66 NuclAT_19 - -
- (5101759) 5101759..5101824 + 66 NuclAT_19 - -
- (5101759) 5101759..5101824 + 66 NuclAT_19 - -
- (5101759) 5101759..5101824 + 66 NuclAT_20 - -
- (5101759) 5101759..5101824 + 66 NuclAT_20 - -
- (5101759) 5101759..5101824 + 66 NuclAT_20 - -
- (5101759) 5101759..5101824 + 66 NuclAT_20 - -
- (5101759) 5101759..5101824 + 66 NuclAT_21 - -
- (5101759) 5101759..5101824 + 66 NuclAT_21 - -
- (5101759) 5101759..5101824 + 66 NuclAT_21 - -
- (5101759) 5101759..5101824 + 66 NuclAT_21 - -
- (5101759) 5101759..5101824 + 66 NuclAT_22 - -
- (5101759) 5101759..5101824 + 66 NuclAT_22 - -
- (5101759) 5101759..5101824 + 66 NuclAT_22 - -
- (5101759) 5101759..5101824 + 66 NuclAT_22 - -
- (5101759) 5101759..5101824 + 66 NuclAT_23 - -
- (5101759) 5101759..5101824 + 66 NuclAT_23 - -
- (5101759) 5101759..5101824 + 66 NuclAT_23 - -
- (5101759) 5101759..5101824 + 66 NuclAT_23 - -
QJP75_RS24975 (5102114) 5102114..5103214 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP75_RS24980 (5103484) 5103484..5103723 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP75_RS24985 (5103872) 5103872..5104567 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP75_RS24990 (5104611) 5104611..5104964 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP75_RS24995 (5105149) 5105149..5106543 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279872 WP_001531632.1 NZ_CP124367:c5101709-5101602 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279872 NZ_CP124367:5101757-5101823 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References