Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4252652..4253331 | Replicon | chromosome |
Accession | NZ_CP124367 | ||
Organism | Escherichia coli strain AVS0465 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP75_RS20590 | Protein ID | WP_000057523.1 |
Coordinates | 4252652..4252954 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP75_RS20595 | Protein ID | WP_000806442.1 |
Coordinates | 4252990..4253331 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP75_RS20565 (4248028) | 4248028..4249680 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QJP75_RS20570 (4249718) | 4249718..4250221 | - | 504 | WP_000667000.1 | hypothetical protein | - |
QJP75_RS20575 (4250218) | 4250218..4251018 | - | 801 | WP_000439798.1 | hypothetical protein | - |
QJP75_RS20580 (4251042) | 4251042..4251521 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP75_RS20585 (4251725) | 4251725..4252519 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP75_RS20590 (4252652) | 4252652..4252954 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP75_RS20595 (4252990) | 4252990..4253331 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP75_RS20600 (4253389) | 4253389..4255893 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP75_RS20605 (4256155) | 4256155..4257087 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279871 WP_000057523.1 NZ_CP124367:4252652-4252954 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|