Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2997749..2998351 | Replicon | chromosome |
Accession | NZ_CP124367 | ||
Organism | Escherichia coli strain AVS0465 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QJP75_RS14595 | Protein ID | WP_000897302.1 |
Coordinates | 2997749..2998060 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP75_RS14600 | Protein ID | WP_000356397.1 |
Coordinates | 2998061..2998351 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP75_RS14570 (2993663) | 2993663..2994262 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
QJP75_RS14575 (2994256) | 2994256..2995128 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QJP75_RS14580 (2995125) | 2995125..2995562 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QJP75_RS14585 (2995607) | 2995607..2996548 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QJP75_RS14590 (2996612) | 2996612..2997520 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QJP75_RS14595 (2997749) | 2997749..2998060 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QJP75_RS14600 (2998061) | 2998061..2998351 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QJP75_RS14605 (2998710) | 2998710..2998988 | + | 279 | WP_001296612.1 | hypothetical protein | - |
QJP75_RS14610 (2999385) | 2999385..2999603 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QJP75_RS14615 (2999788) | 2999788..3000528 | - | 741 | WP_000608806.1 | hypothetical protein | - |
QJP75_RS14620 (3000553) | 3000553..3001401 | - | 849 | WP_001038650.1 | hypothetical protein | - |
QJP75_RS14625 (3001691) | 3001691..3001933 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QJP75_RS14630 (3002115) | 3002115..3003044 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279862 WP_000897302.1 NZ_CP124367:2997749-2998060 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|