Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3597541..3598220 | Replicon | chromosome |
| Accession | NZ_CP124357 | ||
| Organism | Escherichia coli strain AVS0467 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP58_RS17615 | Protein ID | WP_000057523.1 |
| Coordinates | 3597918..3598220 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP58_RS17610 | Protein ID | WP_000806442.1 |
| Coordinates | 3597541..3597882 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP58_RS17600 (3593785) | 3593785..3594717 | - | 933 | WP_000883041.1 | glutaminase A | - |
| QJP58_RS17605 (3594979) | 3594979..3597483 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP58_RS17610 (3597541) | 3597541..3597882 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP58_RS17615 (3597918) | 3597918..3598220 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP58_RS17620 (3598353) | 3598353..3599147 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP58_RS17625 (3599351) | 3599351..3599830 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP58_RS17630 (3599854) | 3599854..3600654 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP58_RS17635 (3600651) | 3600651..3601154 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP58_RS17640 (3601192) | 3601192..3602844 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279819 WP_000057523.1 NZ_CP124357:c3598220-3597918 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|