Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 116579..116812 | Replicon | plasmid pAVS0171-A |
| Accession | NZ_CP124356 | ||
| Organism | Escherichia coli strain AVS0171 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJB00_RS26865 | Protein ID | WP_001372321.1 |
| Coordinates | 116579..116704 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 116781..116812 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB00_RS26825 (111951) | 111951..112640 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJB00_RS26830 (112827) | 112827..113210 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJB00_RS26835 (113545) | 113545..114135 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJB00_RS26840 (114432) | 114432..115253 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJB00_RS26845 (115371) | 115371..115658 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJB00_RS26850 (115683) | 115683..115889 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| QJB00_RS26855 (115959) | 115959..116131 | + | 173 | Protein_135 | hypothetical protein | - |
| QJB00_RS26860 (116129) | 116129..116359 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| QJB00_RS26865 (116579) | 116579..116704 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJB00_RS26870 (116646) | 116646..116795 | - | 150 | Protein_138 | plasmid maintenance protein Mok | - |
| - (116781) | 116781..116812 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116781) | 116781..116812 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116781) | 116781..116812 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116781) | 116781..116812 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (118254) | 118254..118451 | - | 198 | NuclAT_0 | - | - |
| - (118254) | 118254..118451 | - | 198 | NuclAT_0 | - | - |
| - (118254) | 118254..118451 | - | 198 | NuclAT_0 | - | - |
| - (118254) | 118254..118451 | - | 198 | NuclAT_0 | - | - |
| QJB00_RS26880 (118263) | 118263..118451 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJB00_RS26885 (118420) | 118420..119182 | - | 763 | Protein_141 | plasmid SOS inhibition protein A | - |
| QJB00_RS26890 (119179) | 119179..119613 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJB00_RS26895 (119668) | 119668..119865 | - | 198 | Protein_143 | hypothetical protein | - |
| QJB00_RS26900 (119893) | 119893..120126 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJB00_RS26905 (120194) | 120194..120691 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB / iutA / iutA / iutA / iutA / iutA / iucD / iucD | 1..149660 | 149660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279800 WP_001372321.1 NZ_CP124356:c116704-116579 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279800 NZ_CP124356:c116812-116781 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|