Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 76510..76764 | Replicon | plasmid pAVS0171-A |
| Accession | NZ_CP124356 | ||
| Organism | Escherichia coli strain AVS0171 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJB00_RS26620 | Protein ID | WP_001312851.1 |
| Coordinates | 76510..76659 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 76703..76764 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB00_RS26590 (71757) | 71757..72668 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJB00_RS26595 (72679) | 72679..73899 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJB00_RS26600 (74606) | 74606..75220 | + | 615 | Protein_84 | VENN motif pre-toxin domain-containing protein | - |
| QJB00_RS26605 (75220) | 75220..75666 | - | 447 | Protein_85 | plasmid replication initiator RepA | - |
| QJB00_RS26610 (75659) | 75659..75733 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJB00_RS26615 (75969) | 75969..76226 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJB00_RS26620 (76510) | 76510..76659 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (76703) | 76703..76764 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76703) | 76703..76764 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76703) | 76703..76764 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76703) | 76703..76764 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJB00_RS26625 (76903) | 76903..77085 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJB00_RS26630 (77186) | 77186..77802 | + | 617 | Protein_90 | IS1-like element IS1A family transposase | - |
| QJB00_RS26635 (77840) | 77840..79411 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJB00_RS26640 (79431) | 79431..79778 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJB00_RS26645 (79778) | 79778..80455 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJB00_RS26650 (80510) | 80510..80599 | + | 90 | Protein_94 | IS1 family transposase | - |
| QJB00_RS26655 (80900) | 80900..81112 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB / iutA / iutA / iutA / iutA / iutA / iucD / iucD | 1..149660 | 149660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279796 WP_001312851.1 NZ_CP124356:c76659-76510 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279796 NZ_CP124356:76703-76764 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
