Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 75801..76034 | Replicon | plasmid pAVS0226-A |
| Accession | NZ_CP124354 | ||
| Organism | Escherichia coli strain AVS0226 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP71_RS26620 | Protein ID | WP_001372321.1 |
| Coordinates | 75801..75926 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 76003..76034 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP71_RS26580 (71175) | 71175..71864 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP71_RS26585 (72051) | 72051..72434 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP71_RS26590 (72767) | 72767..73357 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJP71_RS26595 (73654) | 73654..74475 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP71_RS26600 (74593) | 74593..74880 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP71_RS26605 (74905) | 74905..75111 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| QJP71_RS26610 (75181) | 75181..75353 | + | 173 | Protein_89 | hypothetical protein | - |
| QJP71_RS26615 (75351) | 75351..75581 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| QJP71_RS26620 (75801) | 75801..75926 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP71_RS26625 (75868) | 75868..76017 | - | 150 | Protein_92 | plasmid maintenance protein Mok | - |
| - (76003) | 76003..76034 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (76003) | 76003..76034 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (76003) | 76003..76034 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (76003) | 76003..76034 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (77476) | 77476..77673 | - | 198 | NuclAT_0 | - | - |
| - (77476) | 77476..77673 | - | 198 | NuclAT_0 | - | - |
| - (77476) | 77476..77673 | - | 198 | NuclAT_0 | - | - |
| - (77476) | 77476..77673 | - | 198 | NuclAT_0 | - | - |
| QJP71_RS26635 (77485) | 77485..77673 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP71_RS26640 (77642) | 77642..78404 | - | 763 | Protein_95 | plasmid SOS inhibition protein A | - |
| QJP71_RS26645 (78401) | 78401..78835 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP71_RS26650 (78890) | 78890..79087 | - | 198 | Protein_97 | hypothetical protein | - |
| QJP71_RS26655 (79115) | 79115..79348 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP71_RS26660 (79416) | 79416..79913 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..108889 | 108889 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279765 WP_001372321.1 NZ_CP124354:c75926-75801 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279765 NZ_CP124354:c76034-76003 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
