Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35734..35988 | Replicon | plasmid pAVS0226-A |
| Accession | NZ_CP124354 | ||
| Organism | Escherichia coli strain AVS0226 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP71_RS26375 | Protein ID | WP_001312851.1 |
| Coordinates | 35734..35883 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 35927..35988 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP71_RS26345 (30981) | 30981..31892 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP71_RS26350 (31903) | 31903..33123 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP71_RS26355 (33830) | 33830..34444 | + | 615 | Protein_38 | VENN motif pre-toxin domain-containing protein | - |
| QJP71_RS26360 (34444) | 34444..34890 | - | 447 | Protein_39 | plasmid replication initiator RepA | - |
| QJP71_RS26365 (34883) | 34883..34957 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| QJP71_RS26370 (35193) | 35193..35450 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP71_RS26375 (35734) | 35734..35883 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (35927) | 35927..35988 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35927) | 35927..35988 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35927) | 35927..35988 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (35927) | 35927..35988 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP71_RS26380 (36127) | 36127..36309 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP71_RS26385 (36410) | 36410..37026 | + | 617 | Protein_44 | IS1-like element IS1A family transposase | - |
| QJP71_RS26390 (37064) | 37064..38635 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP71_RS26395 (38655) | 38655..39002 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP71_RS26400 (39002) | 39002..39679 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP71_RS26405 (39734) | 39734..39823 | + | 90 | Protein_48 | IS1 family transposase | - |
| QJP71_RS26410 (40124) | 40124..40336 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..108889 | 108889 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279761 WP_001312851.1 NZ_CP124354:c35883-35734 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279761 NZ_CP124354:35927-35988 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
