Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4360720..4361399 | Replicon | chromosome |
| Accession | NZ_CP124353 | ||
| Organism | Escherichia coli strain AVS0226 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP71_RS21340 | Protein ID | WP_000057523.1 |
| Coordinates | 4360720..4361022 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP71_RS21345 | Protein ID | WP_000806442.1 |
| Coordinates | 4361058..4361399 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP71_RS21315 (4356096) | 4356096..4357748 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QJP71_RS21320 (4357786) | 4357786..4358289 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP71_RS21325 (4358286) | 4358286..4359086 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP71_RS21330 (4359110) | 4359110..4359589 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP71_RS21335 (4359793) | 4359793..4360587 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP71_RS21340 (4360720) | 4360720..4361022 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP71_RS21345 (4361058) | 4361058..4361399 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP71_RS21350 (4361457) | 4361457..4363961 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP71_RS21355 (4364223) | 4364223..4365155 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279756 WP_000057523.1 NZ_CP124353:4360720-4361022 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|