Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3054307..3054909 | Replicon | chromosome |
Accession | NZ_CP124353 | ||
Organism | Escherichia coli strain AVS0226 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QJP71_RS15145 | Protein ID | WP_000897302.1 |
Coordinates | 3054307..3054618 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP71_RS15150 | Protein ID | WP_000356397.1 |
Coordinates | 3054619..3054909 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP71_RS15120 (3050221) | 3050221..3050820 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
QJP71_RS15125 (3050814) | 3050814..3051686 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QJP71_RS15130 (3051683) | 3051683..3052120 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
QJP71_RS15135 (3052165) | 3052165..3053106 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QJP71_RS15140 (3053170) | 3053170..3054078 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
QJP71_RS15145 (3054307) | 3054307..3054618 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QJP71_RS15150 (3054619) | 3054619..3054909 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QJP71_RS15155 (3055268) | 3055268..3055546 | + | 279 | WP_001296612.1 | hypothetical protein | - |
QJP71_RS15160 (3055943) | 3055943..3056161 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
QJP71_RS15165 (3056346) | 3056346..3057086 | - | 741 | WP_000608806.1 | hypothetical protein | - |
QJP71_RS15170 (3057111) | 3057111..3057959 | - | 849 | WP_001038650.1 | hypothetical protein | - |
QJP71_RS15175 (3058249) | 3058249..3058491 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
QJP71_RS15180 (3058673) | 3058673..3059602 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279747 WP_000897302.1 NZ_CP124353:3054307-3054618 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|