Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72822..73055 | Replicon | plasmid pAVS0362-A |
| Accession | NZ_CP124352 | ||
| Organism | Escherichia coli strain AVS0362 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP84_RS26600 | Protein ID | WP_001372321.1 |
| Coordinates | 72822..72947 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 73024..73055 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP84_RS26560 (68196) | 68196..68885 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP84_RS26565 (69072) | 69072..69455 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP84_RS26570 (69788) | 69788..70378 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJP84_RS26575 (70675) | 70675..71496 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP84_RS26580 (71614) | 71614..71901 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP84_RS26585 (71926) | 71926..72132 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| QJP84_RS26590 (72202) | 72202..72374 | + | 173 | Protein_85 | hypothetical protein | - |
| QJP84_RS26595 (72372) | 72372..72602 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| QJP84_RS26600 (72822) | 72822..72947 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP84_RS26605 (72889) | 72889..73038 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (73024) | 73024..73055 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73024) | 73024..73055 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73024) | 73024..73055 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73024) | 73024..73055 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (74497) | 74497..74694 | - | 198 | NuclAT_0 | - | - |
| - (74497) | 74497..74694 | - | 198 | NuclAT_0 | - | - |
| - (74497) | 74497..74694 | - | 198 | NuclAT_0 | - | - |
| - (74497) | 74497..74694 | - | 198 | NuclAT_0 | - | - |
| QJP84_RS26615 (74506) | 74506..74694 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP84_RS26620 (74663) | 74663..75425 | - | 763 | Protein_91 | plasmid SOS inhibition protein A | - |
| QJP84_RS26625 (75422) | 75422..75856 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP84_RS26630 (75911) | 75911..76108 | - | 198 | Protein_93 | hypothetical protein | - |
| QJP84_RS26635 (76136) | 76136..76369 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP84_RS26640 (76437) | 76437..76934 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iutA / iucD | 1..105909 | 105909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279730 WP_001372321.1 NZ_CP124352:c72947-72822 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279730 NZ_CP124352:c73055-73024 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
