Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32755..33009 | Replicon | plasmid pAVS0362-A |
| Accession | NZ_CP124352 | ||
| Organism | Escherichia coli strain AVS0362 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP84_RS26355 | Protein ID | WP_001312851.1 |
| Coordinates | 32755..32904 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 32948..33009 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP84_RS26325 (28002) | 28002..28913 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP84_RS26330 (28924) | 28924..30144 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP84_RS26335 (30851) | 30851..31465 | + | 615 | Protein_34 | VENN motif pre-toxin domain-containing protein | - |
| QJP84_RS26340 (31465) | 31465..31911 | - | 447 | Protein_35 | plasmid replication initiator RepA | - |
| QJP84_RS26345 (31904) | 31904..31978 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP84_RS26350 (32214) | 32214..32471 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP84_RS26355 (32755) | 32755..32904 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (32948) | 32948..33009 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32948) | 32948..33009 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32948) | 32948..33009 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32948) | 32948..33009 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP84_RS26360 (33148) | 33148..33330 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP84_RS26365 (33431) | 33431..34047 | + | 617 | Protein_40 | IS1-like element IS1A family transposase | - |
| QJP84_RS26370 (34085) | 34085..35656 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP84_RS26375 (35676) | 35676..36023 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP84_RS26380 (36023) | 36023..36700 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP84_RS26385 (36755) | 36755..36844 | + | 90 | Protein_44 | IS1 family transposase | - |
| QJP84_RS26390 (37145) | 37145..37357 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iutA / iucD | 1..105909 | 105909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279726 WP_001312851.1 NZ_CP124352:c32904-32755 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279726 NZ_CP124352:32948-33009 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|