Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72821..73054 | Replicon | plasmid pAVS0453-A |
| Accession | NZ_CP124350 | ||
| Organism | Escherichia coli strain AVS0453 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP64_RS26615 | Protein ID | WP_001372321.1 |
| Coordinates | 72821..72946 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 73023..73054 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP64_RS26575 (68195) | 68195..68884 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP64_RS26580 (69071) | 69071..69454 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP64_RS26585 (69787) | 69787..70377 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJP64_RS26590 (70674) | 70674..71495 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP64_RS26595 (71613) | 71613..71900 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP64_RS26600 (71925) | 71925..72131 | - | 207 | WP_024188037.1 | hypothetical protein | - |
| QJP64_RS26605 (72201) | 72201..72373 | + | 173 | Protein_85 | hypothetical protein | - |
| QJP64_RS26610 (72371) | 72371..72601 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| QJP64_RS26615 (72821) | 72821..72946 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP64_RS26620 (72888) | 72888..73037 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (73023) | 73023..73054 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73023) | 73023..73054 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73023) | 73023..73054 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73023) | 73023..73054 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (74496) | 74496..74693 | - | 198 | NuclAT_0 | - | - |
| - (74496) | 74496..74693 | - | 198 | NuclAT_0 | - | - |
| - (74496) | 74496..74693 | - | 198 | NuclAT_0 | - | - |
| - (74496) | 74496..74693 | - | 198 | NuclAT_0 | - | - |
| QJP64_RS26630 (74505) | 74505..74693 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP64_RS26635 (74662) | 74662..75424 | - | 763 | Protein_91 | plasmid SOS inhibition protein A | - |
| QJP64_RS26640 (75421) | 75421..75855 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP64_RS26645 (75910) | 75910..76107 | - | 198 | Protein_93 | hypothetical protein | - |
| QJP64_RS26650 (76135) | 76135..76368 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP64_RS26655 (76436) | 76436..76933 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..105823 | 105823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279695 WP_001372321.1 NZ_CP124350:c72946-72821 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279695 NZ_CP124350:c73054-73023 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
