Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32754..33008 | Replicon | plasmid pAVS0453-A |
| Accession | NZ_CP124350 | ||
| Organism | Escherichia coli strain AVS0453 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP64_RS26370 | Protein ID | WP_001312851.1 |
| Coordinates | 32754..32903 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 32947..33008 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP64_RS26340 (28001) | 28001..28912 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP64_RS26345 (28923) | 28923..30143 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP64_RS26350 (30850) | 30850..31464 | + | 615 | Protein_34 | VENN motif pre-toxin domain-containing protein | - |
| QJP64_RS26355 (31464) | 31464..31910 | - | 447 | Protein_35 | plasmid replication initiator RepA | - |
| QJP64_RS26360 (31903) | 31903..31977 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP64_RS26365 (32213) | 32213..32470 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP64_RS26370 (32754) | 32754..32903 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (32947) | 32947..33008 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32947) | 32947..33008 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32947) | 32947..33008 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32947) | 32947..33008 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP64_RS26375 (33147) | 33147..33329 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP64_RS26380 (33430) | 33430..34046 | + | 617 | Protein_40 | IS1-like element IS1A family transposase | - |
| QJP64_RS26385 (34084) | 34084..35655 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP64_RS26390 (35675) | 35675..36022 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP64_RS26395 (36022) | 36022..36699 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP64_RS26400 (36754) | 36754..36843 | + | 90 | Protein_44 | IS1 family transposase | - |
| QJP64_RS26405 (37144) | 37144..37356 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..105823 | 105823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279691 WP_001312851.1 NZ_CP124350:c32903-32754 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279691 NZ_CP124350:32947-33008 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|