Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5212280..5212501 Replicon chromosome
Accession NZ_CP124349
Organism Escherichia coli strain AVS0453

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP64_RS25735 Protein ID WP_001531632.1
Coordinates 5212280..5212387 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5212435..5212501 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP64_RS25710 (5208124) 5208124..5209206 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP64_RS25715 (5209206) 5209206..5210039 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP64_RS25720 (5210036) 5210036..5210428 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP64_RS25725 (5210432) 5210432..5211241 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP64_RS25730 (5211277) 5211277..5212131 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP64_RS25735 (5212280) 5212280..5212387 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5212437) 5212437..5212500 + 64 NuclAT_12 - -
- (5212437) 5212437..5212500 + 64 NuclAT_12 - -
- (5212437) 5212437..5212500 + 64 NuclAT_12 - -
- (5212437) 5212437..5212500 + 64 NuclAT_12 - -
- (5212437) 5212437..5212500 + 64 NuclAT_13 - -
- (5212437) 5212437..5212500 + 64 NuclAT_13 - -
- (5212437) 5212437..5212500 + 64 NuclAT_13 - -
- (5212437) 5212437..5212500 + 64 NuclAT_13 - -
- (5212437) 5212437..5212500 + 64 NuclAT_14 - -
- (5212437) 5212437..5212500 + 64 NuclAT_14 - -
- (5212437) 5212437..5212500 + 64 NuclAT_14 - -
- (5212437) 5212437..5212500 + 64 NuclAT_14 - -
- (5212437) 5212437..5212500 + 64 NuclAT_15 - -
- (5212437) 5212437..5212500 + 64 NuclAT_15 - -
- (5212437) 5212437..5212500 + 64 NuclAT_15 - -
- (5212437) 5212437..5212500 + 64 NuclAT_15 - -
- (5212437) 5212437..5212500 + 64 NuclAT_16 - -
- (5212437) 5212437..5212500 + 64 NuclAT_16 - -
- (5212437) 5212437..5212500 + 64 NuclAT_16 - -
- (5212437) 5212437..5212500 + 64 NuclAT_16 - -
- (5212437) 5212437..5212500 + 64 NuclAT_17 - -
- (5212437) 5212437..5212500 + 64 NuclAT_17 - -
- (5212437) 5212437..5212500 + 64 NuclAT_17 - -
- (5212437) 5212437..5212500 + 64 NuclAT_17 - -
- (5212435) 5212435..5212501 + 67 NuclAT_10 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_10 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_10 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_10 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_5 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_5 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_5 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_5 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_6 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_6 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_6 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_6 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_7 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_7 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_7 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_7 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_8 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_8 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_8 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_8 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_9 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_9 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_9 - Antitoxin
- (5212435) 5212435..5212501 + 67 NuclAT_9 - Antitoxin
- (5212437) 5212437..5212502 + 66 NuclAT_18 - -
- (5212437) 5212437..5212502 + 66 NuclAT_18 - -
- (5212437) 5212437..5212502 + 66 NuclAT_18 - -
- (5212437) 5212437..5212502 + 66 NuclAT_18 - -
- (5212437) 5212437..5212502 + 66 NuclAT_19 - -
- (5212437) 5212437..5212502 + 66 NuclAT_19 - -
- (5212437) 5212437..5212502 + 66 NuclAT_19 - -
- (5212437) 5212437..5212502 + 66 NuclAT_19 - -
- (5212437) 5212437..5212502 + 66 NuclAT_20 - -
- (5212437) 5212437..5212502 + 66 NuclAT_20 - -
- (5212437) 5212437..5212502 + 66 NuclAT_20 - -
- (5212437) 5212437..5212502 + 66 NuclAT_20 - -
- (5212437) 5212437..5212502 + 66 NuclAT_21 - -
- (5212437) 5212437..5212502 + 66 NuclAT_21 - -
- (5212437) 5212437..5212502 + 66 NuclAT_21 - -
- (5212437) 5212437..5212502 + 66 NuclAT_21 - -
- (5212437) 5212437..5212502 + 66 NuclAT_22 - -
- (5212437) 5212437..5212502 + 66 NuclAT_22 - -
- (5212437) 5212437..5212502 + 66 NuclAT_22 - -
- (5212437) 5212437..5212502 + 66 NuclAT_22 - -
- (5212437) 5212437..5212502 + 66 NuclAT_23 - -
- (5212437) 5212437..5212502 + 66 NuclAT_23 - -
- (5212437) 5212437..5212502 + 66 NuclAT_23 - -
- (5212437) 5212437..5212502 + 66 NuclAT_23 - -
QJP64_RS25740 (5212792) 5212792..5213892 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP64_RS25745 (5214162) 5214162..5214401 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP64_RS25750 (5214550) 5214550..5215245 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP64_RS25755 (5215289) 5215289..5215642 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP64_RS25760 (5215827) 5215827..5217221 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279687 WP_001531632.1 NZ_CP124349:c5212387-5212280 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279687 NZ_CP124349:5212435-5212501 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References