Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3054299..3054901 | Replicon | chromosome |
| Accession | NZ_CP124349 | ||
| Organism | Escherichia coli strain AVS0453 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP64_RS15145 | Protein ID | WP_000897302.1 |
| Coordinates | 3054299..3054610 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP64_RS15150 | Protein ID | WP_000356397.1 |
| Coordinates | 3054611..3054901 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP64_RS15120 (3050213) | 3050213..3050812 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP64_RS15125 (3050806) | 3050806..3051678 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP64_RS15130 (3051675) | 3051675..3052112 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP64_RS15135 (3052157) | 3052157..3053098 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP64_RS15140 (3053162) | 3053162..3054070 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP64_RS15145 (3054299) | 3054299..3054610 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP64_RS15150 (3054611) | 3054611..3054901 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP64_RS15155 (3054986) | 3054986..3055198 | + | 213 | WP_000197774.1 | hypothetical protein | - |
| QJP64_RS15160 (3055260) | 3055260..3055538 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP64_RS15165 (3055935) | 3055935..3056153 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP64_RS15170 (3056338) | 3056338..3057078 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP64_RS15175 (3057103) | 3057103..3057951 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP64_RS15180 (3058241) | 3058241..3058483 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP64_RS15185 (3058665) | 3058665..3059594 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279677 WP_000897302.1 NZ_CP124349:3054299-3054610 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|