Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3574382..3575061 | Replicon | chromosome |
Accession | NZ_CP124341 | ||
Organism | Escherichia coli strain AVS0710 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJB06_RS17545 | Protein ID | WP_000057523.1 |
Coordinates | 3574759..3575061 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJB06_RS17540 | Protein ID | WP_000806442.1 |
Coordinates | 3574382..3574723 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB06_RS17530 (3570626) | 3570626..3571558 | - | 933 | WP_000883041.1 | glutaminase A | - |
QJB06_RS17535 (3571820) | 3571820..3574324 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJB06_RS17540 (3574382) | 3574382..3574723 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJB06_RS17545 (3574759) | 3574759..3575061 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJB06_RS17550 (3575194) | 3575194..3575988 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJB06_RS17555 (3576192) | 3576192..3576671 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJB06_RS17560 (3576695) | 3576695..3577495 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QJB06_RS17565 (3577492) | 3577492..3577995 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QJB06_RS17570 (3578033) | 3578033..3579685 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279591 WP_000057523.1 NZ_CP124341:c3575061-3574759 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|