Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3562882..3563681 | Replicon | chromosome |
| Accession | NZ_CP124334 | ||
| Organism | Escherichia coli strain AVS0786 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | QJP89_RS17465 | Protein ID | WP_000347251.1 |
| Coordinates | 3562882..3563346 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QJP89_RS17470 | Protein ID | WP_001296435.1 |
| Coordinates | 3563346..3563681 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP89_RS17435 (3557883) | 3557883..3558317 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QJP89_RS17440 (3558335) | 3558335..3559213 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QJP89_RS17445 (3559203) | 3559203..3559982 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QJP89_RS17450 (3559993) | 3559993..3560466 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QJP89_RS17455 (3560489) | 3560489..3561769 | - | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QJP89_RS17460 (3562018) | 3562018..3562827 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QJP89_RS17465 (3562882) | 3562882..3563346 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QJP89_RS17470 (3563346) | 3563346..3563681 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QJP89_RS17475 (3563830) | 3563830..3565401 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QJP89_RS17480 (3565776) | 3565776..3567110 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QJP89_RS17485 (3567126) | 3567126..3567896 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T279527 WP_000347251.1 NZ_CP124334:c3563346-3562882 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |