Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1466538..1467217 | Replicon | chromosome |
| Accession | NZ_CP124334 | ||
| Organism | Escherichia coli strain AVS0786 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP89_RS07480 | Protein ID | WP_000057523.1 |
| Coordinates | 1466915..1467217 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP89_RS07475 | Protein ID | WP_000806442.1 |
| Coordinates | 1466538..1466879 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP89_RS07465 (1462782) | 1462782..1463714 | - | 933 | WP_000883041.1 | glutaminase A | - |
| QJP89_RS07470 (1463976) | 1463976..1466480 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP89_RS07475 (1466538) | 1466538..1466879 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP89_RS07480 (1466915) | 1466915..1467217 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP89_RS07485 (1467350) | 1467350..1468144 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP89_RS07490 (1468348) | 1468348..1468827 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP89_RS07495 (1468851) | 1468851..1469651 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP89_RS07500 (1469648) | 1469648..1470151 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP89_RS07505 (1470189) | 1470189..1471841 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279517 WP_000057523.1 NZ_CP124334:c1467217-1466915 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|