Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72819..73052 | Replicon | plasmid pAVS0753-A |
| Accession | NZ_CP124333 | ||
| Organism | Escherichia coli strain AVS0753 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP82_RS26630 | Protein ID | WP_001372321.1 |
| Coordinates | 72819..72944 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 73021..73052 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP82_RS26590 (68193) | 68193..68882 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP82_RS26595 (69069) | 69069..69452 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP82_RS26600 (69785) | 69785..70375 | + | 591 | WP_192849409.1 | transglycosylase SLT domain-containing protein | - |
| QJP82_RS26605 (70672) | 70672..71493 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP82_RS26610 (71611) | 71611..71898 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP82_RS26615 (71923) | 71923..72129 | - | 207 | WP_000275855.1 | hypothetical protein | - |
| QJP82_RS26620 (72199) | 72199..72371 | + | 173 | Protein_85 | hypothetical protein | - |
| QJP82_RS26625 (72369) | 72369..72599 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| QJP82_RS26630 (72819) | 72819..72944 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP82_RS26635 (72886) | 72886..73035 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (73021) | 73021..73052 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73021) | 73021..73052 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73021) | 73021..73052 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (73021) | 73021..73052 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (74494) | 74494..74691 | - | 198 | NuclAT_0 | - | - |
| - (74494) | 74494..74691 | - | 198 | NuclAT_0 | - | - |
| - (74494) | 74494..74691 | - | 198 | NuclAT_0 | - | - |
| - (74494) | 74494..74691 | - | 198 | NuclAT_0 | - | - |
| QJP82_RS26645 (74503) | 74503..74691 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP82_RS26650 (74660) | 74660..75422 | - | 763 | Protein_91 | plasmid SOS inhibition protein A | - |
| QJP82_RS26655 (75419) | 75419..75853 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP82_RS26660 (75908) | 75908..76105 | - | 198 | Protein_93 | hypothetical protein | - |
| QJP82_RS26665 (76133) | 76133..76366 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP82_RS26670 (76434) | 76434..76931 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..105993 | 105993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279507 WP_001372321.1 NZ_CP124333:c72944-72819 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279507 NZ_CP124333:c73052-73021 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
