Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32752..33006 | Replicon | plasmid pAVS0753-A |
| Accession | NZ_CP124333 | ||
| Organism | Escherichia coli strain AVS0753 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP82_RS26385 | Protein ID | WP_001312851.1 |
| Coordinates | 32752..32901 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 32945..33006 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP82_RS26355 (27999) | 27999..28910 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP82_RS26360 (28921) | 28921..30141 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP82_RS26365 (30848) | 30848..31462 | + | 615 | Protein_34 | VENN motif pre-toxin domain-containing protein | - |
| QJP82_RS26370 (31462) | 31462..31908 | - | 447 | Protein_35 | plasmid replication initiator RepA | - |
| QJP82_RS26375 (31901) | 31901..31975 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP82_RS26380 (32211) | 32211..32468 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP82_RS26385 (32752) | 32752..32901 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (32945) | 32945..33006 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32945) | 32945..33006 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32945) | 32945..33006 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (32945) | 32945..33006 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP82_RS26390 (33145) | 33145..33327 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP82_RS26395 (33428) | 33428..34044 | + | 617 | Protein_40 | IS1-like element IS1A family transposase | - |
| QJP82_RS26400 (34082) | 34082..35653 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP82_RS26405 (35673) | 35673..36020 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP82_RS26410 (36020) | 36020..36697 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP82_RS26415 (36752) | 36752..36841 | + | 90 | Protein_44 | IS1 family transposase | - |
| QJP82_RS26420 (37142) | 37142..37354 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..105993 | 105993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279503 WP_001312851.1 NZ_CP124333:c32901-32752 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279503 NZ_CP124333:32945-33006 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|