Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5212443..5212664 Replicon chromosome
Accession NZ_CP124332
Organism Escherichia coli strain AVS0753

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP82_RS25750 Protein ID WP_001531632.1
Coordinates 5212443..5212550 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5212598..5212664 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP82_RS25725 (5208287) 5208287..5209369 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP82_RS25730 (5209369) 5209369..5210202 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP82_RS25735 (5210199) 5210199..5210591 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP82_RS25740 (5210595) 5210595..5211404 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP82_RS25745 (5211440) 5211440..5212294 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP82_RS25750 (5212443) 5212443..5212550 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5212600) 5212600..5212663 + 64 NuclAT_12 - -
- (5212600) 5212600..5212663 + 64 NuclAT_12 - -
- (5212600) 5212600..5212663 + 64 NuclAT_12 - -
- (5212600) 5212600..5212663 + 64 NuclAT_12 - -
- (5212600) 5212600..5212663 + 64 NuclAT_13 - -
- (5212600) 5212600..5212663 + 64 NuclAT_13 - -
- (5212600) 5212600..5212663 + 64 NuclAT_13 - -
- (5212600) 5212600..5212663 + 64 NuclAT_13 - -
- (5212600) 5212600..5212663 + 64 NuclAT_14 - -
- (5212600) 5212600..5212663 + 64 NuclAT_14 - -
- (5212600) 5212600..5212663 + 64 NuclAT_14 - -
- (5212600) 5212600..5212663 + 64 NuclAT_14 - -
- (5212600) 5212600..5212663 + 64 NuclAT_15 - -
- (5212600) 5212600..5212663 + 64 NuclAT_15 - -
- (5212600) 5212600..5212663 + 64 NuclAT_15 - -
- (5212600) 5212600..5212663 + 64 NuclAT_15 - -
- (5212600) 5212600..5212663 + 64 NuclAT_16 - -
- (5212600) 5212600..5212663 + 64 NuclAT_16 - -
- (5212600) 5212600..5212663 + 64 NuclAT_16 - -
- (5212600) 5212600..5212663 + 64 NuclAT_16 - -
- (5212600) 5212600..5212663 + 64 NuclAT_17 - -
- (5212600) 5212600..5212663 + 64 NuclAT_17 - -
- (5212600) 5212600..5212663 + 64 NuclAT_17 - -
- (5212600) 5212600..5212663 + 64 NuclAT_17 - -
- (5212598) 5212598..5212664 + 67 NuclAT_10 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_10 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_10 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_10 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_5 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_5 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_5 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_5 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_6 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_6 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_6 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_6 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_7 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_7 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_7 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_7 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_8 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_8 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_8 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_8 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_9 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_9 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_9 - Antitoxin
- (5212598) 5212598..5212664 + 67 NuclAT_9 - Antitoxin
- (5212600) 5212600..5212665 + 66 NuclAT_18 - -
- (5212600) 5212600..5212665 + 66 NuclAT_18 - -
- (5212600) 5212600..5212665 + 66 NuclAT_18 - -
- (5212600) 5212600..5212665 + 66 NuclAT_18 - -
- (5212600) 5212600..5212665 + 66 NuclAT_19 - -
- (5212600) 5212600..5212665 + 66 NuclAT_19 - -
- (5212600) 5212600..5212665 + 66 NuclAT_19 - -
- (5212600) 5212600..5212665 + 66 NuclAT_19 - -
- (5212600) 5212600..5212665 + 66 NuclAT_20 - -
- (5212600) 5212600..5212665 + 66 NuclAT_20 - -
- (5212600) 5212600..5212665 + 66 NuclAT_20 - -
- (5212600) 5212600..5212665 + 66 NuclAT_20 - -
- (5212600) 5212600..5212665 + 66 NuclAT_21 - -
- (5212600) 5212600..5212665 + 66 NuclAT_21 - -
- (5212600) 5212600..5212665 + 66 NuclAT_21 - -
- (5212600) 5212600..5212665 + 66 NuclAT_21 - -
- (5212600) 5212600..5212665 + 66 NuclAT_22 - -
- (5212600) 5212600..5212665 + 66 NuclAT_22 - -
- (5212600) 5212600..5212665 + 66 NuclAT_22 - -
- (5212600) 5212600..5212665 + 66 NuclAT_22 - -
- (5212600) 5212600..5212665 + 66 NuclAT_23 - -
- (5212600) 5212600..5212665 + 66 NuclAT_23 - -
- (5212600) 5212600..5212665 + 66 NuclAT_23 - -
- (5212600) 5212600..5212665 + 66 NuclAT_23 - -
QJP82_RS25755 (5212955) 5212955..5214055 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP82_RS25760 (5214325) 5214325..5214564 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP82_RS25765 (5214713) 5214713..5215408 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP82_RS25770 (5215452) 5215452..5215805 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP82_RS25775 (5215990) 5215990..5217384 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279499 WP_001531632.1 NZ_CP124332:c5212550-5212443 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279499 NZ_CP124332:5212598-5212664 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References