Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3054657..3055259 | Replicon | chromosome |
| Accession | NZ_CP124332 | ||
| Organism | Escherichia coli strain AVS0753 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP82_RS15165 | Protein ID | WP_000897302.1 |
| Coordinates | 3054657..3054968 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP82_RS15170 | Protein ID | WP_000356397.1 |
| Coordinates | 3054969..3055259 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP82_RS15140 (3050571) | 3050571..3051170 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJP82_RS15145 (3051164) | 3051164..3052036 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP82_RS15150 (3052033) | 3052033..3052470 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP82_RS15155 (3052515) | 3052515..3053456 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP82_RS15160 (3053520) | 3053520..3054428 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP82_RS15165 (3054657) | 3054657..3054968 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP82_RS15170 (3054969) | 3054969..3055259 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP82_RS15175 (3055344) | 3055344..3055556 | + | 213 | WP_000197774.1 | hypothetical protein | - |
| QJP82_RS15180 (3055618) | 3055618..3055896 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP82_RS15185 (3056293) | 3056293..3056511 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP82_RS15190 (3056696) | 3056696..3057436 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP82_RS15195 (3057461) | 3057461..3058309 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP82_RS15200 (3058599) | 3058599..3058841 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP82_RS15205 (3059023) | 3059023..3059952 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279489 WP_000897302.1 NZ_CP124332:3054657-3054968 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|