Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2200722..2201449 | Replicon | chromosome |
| Accession | NZ_CP124332 | ||
| Organism | Escherichia coli strain AVS0753 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | QJP82_RS10960 | Protein ID | WP_000550189.1 |
| Coordinates | 2201135..2201449 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP82_RS10955 | Protein ID | WP_000560269.1 |
| Coordinates | 2200722..2201138 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP82_RS10945 (2196082) | 2196082..2198433 | + | 2352 | WP_000695432.1 | alpha-glucosidase | - |
| QJP82_RS10950 (2198659) | 2198659..2200677 | + | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| QJP82_RS10955 (2200722) | 2200722..2201138 | - | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QJP82_RS10960 (2201135) | 2201135..2201449 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QJP82_RS10965 (2201734) | 2201734..2202870 | - | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| QJP82_RS10970 (2202955) | 2202955..2203458 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| QJP82_RS10975 (2203535) | 2203535..2204227 | + | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
| QJP82_RS10980 (2204306) | 2204306..2205292 | + | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T279486 WP_000550189.1 NZ_CP124332:c2201449-2201135 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT279486 WP_000560269.1 NZ_CP124332:c2201138-2200722 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|