Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60068..60321 | Replicon | plasmid pAVS0787-B |
| Accession | NZ_CP124330 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP62_RS27435 | Protein ID | WP_001312851.1 |
| Coordinates | 60172..60321 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60068..60127 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS27400 (56002) | 56002..56748 | + | 747 | WP_032188604.1 | conjugal transfer pilus acetylase TraX | - |
| QJP62_RS27405 (56803) | 56803..57363 | + | 561 | WP_282517446.1 | fertility inhibition protein FinO | - |
| QJP62_RS27410 (57495) | 57495..57707 | + | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| QJP62_RS27415 (57953) | 57953..58414 | + | 462 | WP_238061707.1 | thermonuclease family protein | - |
| QJP62_RS27420 (58460) | 58460..58669 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| QJP62_RS27425 (58707) | 58707..59297 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| QJP62_RS27430 (59452) | 59452..59925 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - (60068) | 60068..60127 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60068) | 60068..60127 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60068) | 60068..60127 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60068) | 60068..60127 | - | 60 | NuclAT_1 | - | Antitoxin |
| QJP62_RS27435 (60172) | 60172..60321 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QJP62_RS27440 (60606) | 60606..60854 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| QJP62_RS27445 (60969) | 60969..61153 | + | 185 | Protein_80 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..61165 | 61165 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279475 WP_001312851.1 NZ_CP124330:60172-60321 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT279475 NZ_CP124330:c60127-60068 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|