Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 60068..60321 Replicon plasmid pAVS0787-B
Accession NZ_CP124330
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QJP62_RS27435 Protein ID WP_001312851.1
Coordinates 60172..60321 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 60068..60127 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS27400 (56002) 56002..56748 + 747 WP_032188604.1 conjugal transfer pilus acetylase TraX -
QJP62_RS27405 (56803) 56803..57363 + 561 WP_282517446.1 fertility inhibition protein FinO -
QJP62_RS27410 (57495) 57495..57707 + 213 WP_001301409.1 ANR family transcriptional regulator -
QJP62_RS27415 (57953) 57953..58414 + 462 WP_238061707.1 thermonuclease family protein -
QJP62_RS27420 (58460) 58460..58669 + 210 WP_001298565.1 hemolysin expression modulator Hha -
QJP62_RS27425 (58707) 58707..59297 + 591 WP_033807967.1 DUF2726 domain-containing protein -
QJP62_RS27430 (59452) 59452..59925 + 474 WP_016240489.1 hypothetical protein -
- (60068) 60068..60127 - 60 NuclAT_1 - Antitoxin
- (60068) 60068..60127 - 60 NuclAT_1 - Antitoxin
- (60068) 60068..60127 - 60 NuclAT_1 - Antitoxin
- (60068) 60068..60127 - 60 NuclAT_1 - Antitoxin
QJP62_RS27435 (60172) 60172..60321 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QJP62_RS27440 (60606) 60606..60854 + 249 WP_000083839.1 replication regulatory protein RepA -
QJP62_RS27445 (60969) 60969..61153 + 185 Protein_80 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..61165 61165


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T279475 WP_001312851.1 NZ_CP124330:60172-60321 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT279475 NZ_CP124330:c60127-60068 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References