Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19324..19593 | Replicon | plasmid pAVS0787-B |
| Accession | NZ_CP124330 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP62_RS27185 | Protein ID | WP_001372321.1 |
| Coordinates | 19468..19593 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 19324..19389 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS27145 | 14330..14791 | - | 462 | Protein_20 | hypothetical protein | - |
| QJP62_RS27150 | 15093..15620 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| QJP62_RS27155 | 15678..15911 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QJP62_RS27160 | 15972..17936 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| QJP62_RS27165 | 18005..18439 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QJP62_RS27170 | 18436..19198 | + | 763 | Protein_25 | plasmid SOS inhibition protein A | - |
| - | 19167..19391 | + | 225 | NuclAT_0 | - | - |
| - | 19167..19391 | + | 225 | NuclAT_0 | - | - |
| - | 19167..19391 | + | 225 | NuclAT_0 | - | - |
| - | 19167..19391 | + | 225 | NuclAT_0 | - | - |
| QJP62_RS27175 | 19176..19355 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 19324..19389 | - | 66 | - | - | Antitoxin |
| QJP62_RS27180 | 19377..19526 | + | 150 | Protein_27 | plasmid maintenance protein Mok | - |
| QJP62_RS27185 | 19468..19593 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP62_RS27190 | 19894..20190 | - | 297 | Protein_29 | hypothetical protein | - |
| QJP62_RS27195 | 20490..20786 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| QJP62_RS27200 | 20897..21718 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| QJP62_RS27205 | 22015..22617 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| QJP62_RS27210 | 22938..23321 | + | 384 | WP_001151529.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP62_RS27215 | 23513..24160 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
| QJP62_RS27220 | 24280..24507 | + | 228 | WP_000589556.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..61165 | 61165 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279473 WP_001372321.1 NZ_CP124330:19468-19593 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT279473 NZ_CP124330:c19389-19324 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|