Detailed information of TA system TA279473

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 19324..19593
• Replicon: plasmid pAVS0787-B
• Accession: NZ_CP124330
• Organism: Escherichia coli strain AVS0787

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QJP62_RS27185
• Protein ID: WP_001372321.1
• Coordinates: 19468..19593 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	19324..19389 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QJP62_RS27145	14330..14791	-	462	Protein_20	hypothetical protein	-
QJP62_RS27150	15093..15620	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QJP62_RS27155	15678..15911	+	234	WP_000006003.1	DUF905 family protein	-
QJP62_RS27160	15972..17936	+	1965	WP_000117316.1	ParB/RepB/Spo0J family partition protein	-
QJP62_RS27165	18005..18439	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QJP62_RS27170	18436..19198	+	763	Protein_25	plasmid SOS inhibition protein A	-
-	19167..19391	+	225	NuclAT_0	-	-
-	19167..19391	+	225	NuclAT_0	-	-
-	19167..19391	+	225	NuclAT_0	-	-
-	19167..19391	+	225	NuclAT_0	-	-
QJP62_RS27175	19176..19355	-	180	WP_001309233.1	hypothetical protein	-
-	19324..19389	-	66	-	-	Antitoxin
QJP62_RS27180	19377..19526	+	150	Protein_27	plasmid maintenance protein Mok	-
QJP62_RS27185	19468..19593	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QJP62_RS27190	19894..20190	-	297	Protein_29	hypothetical protein	-
QJP62_RS27195	20490..20786	+	297	WP_001272251.1	hypothetical protein	-
QJP62_RS27200	20897..21718	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QJP62_RS27205	22015..22617	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
QJP62_RS27210	22938..23321	+	384	WP_001151529.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QJP62_RS27215	23513..24160	+	648	WP_000332523.1	transcriptional regulator TraJ family protein	-
QJP62_RS27220	24280..24507	+	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..61165	61165

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T279473 WP_001372321.1 NZ_CP124330:19468-19593 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT279473 NZ_CP124330:c19389-19324 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin