Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 116565..116798 | Replicon | plasmid pAVS0787-A |
| Accession | NZ_CP124329 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP62_RS26835 | Protein ID | WP_001372321.1 |
| Coordinates | 116565..116690 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 116767..116798 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS26800 (111943) | 111943..112632 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP62_RS26805 (112819) | 112819..113202 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP62_RS26810 (113523) | 113523..114125 | + | 603 | WP_077778617.1 | transglycosylase SLT domain-containing protein | - |
| QJP62_RS26815 (114422) | 114422..115243 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QJP62_RS26820 (115360) | 115360..115646 | - | 287 | Protein_133 | hypothetical protein | - |
| QJP62_RS26825 (115671) | 115671..115877 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| QJP62_RS26830 (116116) | 116116..116346 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| QJP62_RS26835 (116565) | 116565..116690 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP62_RS26840 (116632) | 116632..116781 | - | 150 | Protein_137 | plasmid maintenance protein Mok | - |
| - (116767) | 116767..116798 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116767) | 116767..116798 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116767) | 116767..116798 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (116767) | 116767..116798 | - | 32 | NuclAT_1 | - | Antitoxin |
| QJP62_RS26845 (116823) | 116823..118191 | - | 1369 | Protein_138 | IS3-like element IS150 family transposase | - |
| - (118239) | 118239..118436 | - | 198 | NuclAT_0 | - | - |
| - (118239) | 118239..118436 | - | 198 | NuclAT_0 | - | - |
| - (118239) | 118239..118436 | - | 198 | NuclAT_0 | - | - |
| - (118239) | 118239..118436 | - | 198 | NuclAT_0 | - | - |
| QJP62_RS26850 (118248) | 118248..118436 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| QJP62_RS26855 (118405) | 118405..119166 | - | 762 | Protein_140 | plasmid SOS inhibition protein A | - |
| QJP62_RS26860 (119163) | 119163..119597 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| QJP62_RS26865 (119652) | 119652..119849 | - | 198 | Protein_142 | hypothetical protein | - |
| QJP62_RS26870 (119877) | 119877..120110 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QJP62_RS26875 (120178) | 120178..120675 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB / iutA / iutA / iucD | 1..149581 | 149581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T279467 WP_001372321.1 NZ_CP124329:c116690-116565 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT279467 NZ_CP124329:c116798-116767 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|