Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 76524..76778 | Replicon | plasmid pAVS0787-A |
| Accession | NZ_CP124329 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJP62_RS26595 | Protein ID | WP_001312851.1 |
| Coordinates | 76524..76673 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 76717..76778 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS26565 (71771) | 71771..72682 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QJP62_RS26570 (72693) | 72693..73913 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QJP62_RS26575 (74620) | 74620..75234 | + | 615 | Protein_84 | VENN motif pre-toxin domain-containing protein | - |
| QJP62_RS26580 (75234) | 75234..75680 | - | 447 | Protein_85 | plasmid replication initiator RepA | - |
| QJP62_RS26585 (75673) | 75673..75747 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QJP62_RS26590 (75983) | 75983..76240 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QJP62_RS26595 (76524) | 76524..76673 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (76717) | 76717..76778 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76717) | 76717..76778 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76717) | 76717..76778 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (76717) | 76717..76778 | + | 62 | NuclAT_2 | - | Antitoxin |
| QJP62_RS26600 (76917) | 76917..77099 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QJP62_RS26605 (77199) | 77199..77815 | + | 617 | Protein_90 | IS1-like element IS1A family transposase | - |
| QJP62_RS26610 (77853) | 77853..79424 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| QJP62_RS26615 (79444) | 79444..79791 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP62_RS26620 (79791) | 79791..80468 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QJP62_RS26625 (80523) | 80523..80612 | + | 90 | Protein_94 | IS1 family transposase | - |
| QJP62_RS26630 (80870) | 80870..81124 | - | 255 | WP_282517437.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB / iutA / iutA / iucD | 1..149581 | 149581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T279463 WP_001312851.1 NZ_CP124329:c76673-76524 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT279463 NZ_CP124329:76717-76778 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|