Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5212186..5212407 Replicon chromosome
Accession NZ_CP124328
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP62_RS25710 Protein ID WP_001531632.1
Coordinates 5212186..5212293 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5212341..5212407 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS25685 (5208030) 5208030..5209112 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP62_RS25690 (5209112) 5209112..5209945 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP62_RS25695 (5209942) 5209942..5210334 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP62_RS25700 (5210338) 5210338..5211147 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP62_RS25705 (5211183) 5211183..5212037 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP62_RS25710 (5212186) 5212186..5212293 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5212343) 5212343..5212406 + 64 NuclAT_12 - -
- (5212343) 5212343..5212406 + 64 NuclAT_12 - -
- (5212343) 5212343..5212406 + 64 NuclAT_12 - -
- (5212343) 5212343..5212406 + 64 NuclAT_12 - -
- (5212343) 5212343..5212406 + 64 NuclAT_13 - -
- (5212343) 5212343..5212406 + 64 NuclAT_13 - -
- (5212343) 5212343..5212406 + 64 NuclAT_13 - -
- (5212343) 5212343..5212406 + 64 NuclAT_13 - -
- (5212343) 5212343..5212406 + 64 NuclAT_14 - -
- (5212343) 5212343..5212406 + 64 NuclAT_14 - -
- (5212343) 5212343..5212406 + 64 NuclAT_14 - -
- (5212343) 5212343..5212406 + 64 NuclAT_14 - -
- (5212343) 5212343..5212406 + 64 NuclAT_15 - -
- (5212343) 5212343..5212406 + 64 NuclAT_15 - -
- (5212343) 5212343..5212406 + 64 NuclAT_15 - -
- (5212343) 5212343..5212406 + 64 NuclAT_15 - -
- (5212343) 5212343..5212406 + 64 NuclAT_16 - -
- (5212343) 5212343..5212406 + 64 NuclAT_16 - -
- (5212343) 5212343..5212406 + 64 NuclAT_16 - -
- (5212343) 5212343..5212406 + 64 NuclAT_16 - -
- (5212343) 5212343..5212406 + 64 NuclAT_17 - -
- (5212343) 5212343..5212406 + 64 NuclAT_17 - -
- (5212343) 5212343..5212406 + 64 NuclAT_17 - -
- (5212343) 5212343..5212406 + 64 NuclAT_17 - -
- (5212341) 5212341..5212407 + 67 NuclAT_10 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_10 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_10 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_10 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_5 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_5 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_5 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_5 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_6 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_6 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_6 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_6 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_7 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_7 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_7 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_7 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_8 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_8 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_8 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_8 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_9 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_9 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_9 - Antitoxin
- (5212341) 5212341..5212407 + 67 NuclAT_9 - Antitoxin
- (5212343) 5212343..5212408 + 66 NuclAT_18 - -
- (5212343) 5212343..5212408 + 66 NuclAT_18 - -
- (5212343) 5212343..5212408 + 66 NuclAT_18 - -
- (5212343) 5212343..5212408 + 66 NuclAT_18 - -
- (5212343) 5212343..5212408 + 66 NuclAT_19 - -
- (5212343) 5212343..5212408 + 66 NuclAT_19 - -
- (5212343) 5212343..5212408 + 66 NuclAT_19 - -
- (5212343) 5212343..5212408 + 66 NuclAT_19 - -
- (5212343) 5212343..5212408 + 66 NuclAT_20 - -
- (5212343) 5212343..5212408 + 66 NuclAT_20 - -
- (5212343) 5212343..5212408 + 66 NuclAT_20 - -
- (5212343) 5212343..5212408 + 66 NuclAT_20 - -
- (5212343) 5212343..5212408 + 66 NuclAT_21 - -
- (5212343) 5212343..5212408 + 66 NuclAT_21 - -
- (5212343) 5212343..5212408 + 66 NuclAT_21 - -
- (5212343) 5212343..5212408 + 66 NuclAT_21 - -
- (5212343) 5212343..5212408 + 66 NuclAT_22 - -
- (5212343) 5212343..5212408 + 66 NuclAT_22 - -
- (5212343) 5212343..5212408 + 66 NuclAT_22 - -
- (5212343) 5212343..5212408 + 66 NuclAT_22 - -
- (5212343) 5212343..5212408 + 66 NuclAT_23 - -
- (5212343) 5212343..5212408 + 66 NuclAT_23 - -
- (5212343) 5212343..5212408 + 66 NuclAT_23 - -
- (5212343) 5212343..5212408 + 66 NuclAT_23 - -
QJP62_RS25715 (5212698) 5212698..5213798 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP62_RS25720 (5214068) 5214068..5214307 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP62_RS25725 (5214456) 5214456..5215151 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP62_RS25730 (5215195) 5215195..5215548 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP62_RS25735 (5215733) 5215733..5217127 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279459 WP_001531632.1 NZ_CP124328:c5212293-5212186 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279459 NZ_CP124328:5212341-5212407 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References