Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3016670..3017272 | Replicon | chromosome |
| Accession | NZ_CP124328 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP62_RS15080 | Protein ID | WP_000897302.1 |
| Coordinates | 3016961..3017272 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP62_RS15075 | Protein ID | WP_000356397.1 |
| Coordinates | 3016670..3016960 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS15040 (3011977) | 3011977..3012906 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| QJP62_RS15045 (3013088) | 3013088..3013330 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP62_RS15050 (3013620) | 3013620..3014468 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP62_RS15055 (3014493) | 3014493..3015233 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP62_RS15060 (3015418) | 3015418..3015636 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP62_RS15065 (3016033) | 3016033..3016311 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP62_RS15070 (3016373) | 3016373..3016585 | - | 213 | WP_000197774.1 | hypothetical protein | - |
| QJP62_RS15075 (3016670) | 3016670..3016960 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP62_RS15080 (3016961) | 3016961..3017272 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP62_RS15085 (3017501) | 3017501..3018409 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP62_RS15090 (3018473) | 3018473..3019414 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP62_RS15095 (3019459) | 3019459..3019896 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP62_RS15100 (3019893) | 3019893..3020765 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJP62_RS15105 (3020759) | 3020759..3021358 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T279453 WP_000897302.1 NZ_CP124328:c3017272-3016961 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|