Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 184976..186294 | Replicon | chromosome |
Accession | NZ_CP124326 | ||
Organism | Escherichia coli strain AVS0285 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | QJP69_RS00875 | Protein ID | WP_001262467.1 |
Coordinates | 185287..186294 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | QJP69_RS00870 | Protein ID | WP_001312177.1 |
Coordinates | 184976..185287 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP69_RS00845 (180508) | 180508..181527 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
QJP69_RS00850 (181537) | 181537..182439 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
QJP69_RS00855 (182450) | 182450..183433 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
QJP69_RS00860 (183430) | 183430..184443 | + | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QJP69_RS00865 (184668) | 184668..184991 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
QJP69_RS00870 (184976) | 184976..185287 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
QJP69_RS00875 (185287) | 185287..186294 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
QJP69_RS00880 (186311) | 186311..187582 | - | 1272 | WP_001545666.1 | amino acid permease | - |
- (187944) | 187944..188009 | - | 66 | NuclAT_27 | - | - |
- (187944) | 187944..188009 | - | 66 | NuclAT_27 | - | - |
- (187944) | 187944..188009 | - | 66 | NuclAT_27 | - | - |
- (187944) | 187944..188009 | - | 66 | NuclAT_27 | - | - |
QJP69_RS00885 (188058) | 188058..188165 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (188427) | 188427..188484 | - | 58 | NuclAT_26 | - | - |
- (188427) | 188427..188484 | - | 58 | NuclAT_26 | - | - |
- (188427) | 188427..188484 | - | 58 | NuclAT_26 | - | - |
- (188427) | 188427..188484 | - | 58 | NuclAT_26 | - | - |
QJP69_RS00890 (188541) | 188541..188648 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP69_RS00895 (189024) | 189024..189131 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP69_RS00900 (189217) | 189217..190896 | - | 1680 | Protein_177 | cellulose biosynthesis protein BcsG | - |
QJP69_RS00905 (190893) | 190893..191084 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T279415 WP_001262467.1 NZ_CP124326:185287-186294 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |