Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3603045..3603724 | Replicon | chromosome |
Accession | NZ_CP124324 | ||
Organism | Escherichia coli strain AVS0536 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP54_RS17675 | Protein ID | WP_000057523.1 |
Coordinates | 3603422..3603724 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP54_RS17670 | Protein ID | WP_000806442.1 |
Coordinates | 3603045..3603386 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP54_RS17660 (3599289) | 3599289..3600221 | - | 933 | WP_000883041.1 | glutaminase A | - |
QJP54_RS17665 (3600483) | 3600483..3602987 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP54_RS17670 (3603045) | 3603045..3603386 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP54_RS17675 (3603422) | 3603422..3603724 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP54_RS17680 (3603857) | 3603857..3604651 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP54_RS17685 (3604855) | 3604855..3605334 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP54_RS17690 (3605358) | 3605358..3606158 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QJP54_RS17695 (3606155) | 3606155..3606658 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QJP54_RS17700 (3606696) | 3606696..3608348 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279407 WP_000057523.1 NZ_CP124324:c3603724-3603422 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|