Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2414235..2414456 Replicon chromosome
Accession NZ_CP124320
Organism Escherichia coli strain AVS0754

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP81_RS11900 Protein ID WP_001531632.1
Coordinates 2414235..2414342 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2414390..2414456 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP81_RS11875 (2410079) 2410079..2411161 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP81_RS11880 (2411161) 2411161..2411994 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP81_RS11885 (2411991) 2411991..2412383 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP81_RS11890 (2412387) 2412387..2413196 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP81_RS11895 (2413232) 2413232..2414086 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP81_RS11900 (2414235) 2414235..2414342 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2414392) 2414392..2414455 + 64 NuclAT_14 - -
- (2414392) 2414392..2414455 + 64 NuclAT_14 - -
- (2414392) 2414392..2414455 + 64 NuclAT_14 - -
- (2414392) 2414392..2414455 + 64 NuclAT_14 - -
- (2414392) 2414392..2414455 + 64 NuclAT_15 - -
- (2414392) 2414392..2414455 + 64 NuclAT_15 - -
- (2414392) 2414392..2414455 + 64 NuclAT_15 - -
- (2414392) 2414392..2414455 + 64 NuclAT_15 - -
- (2414392) 2414392..2414455 + 64 NuclAT_16 - -
- (2414392) 2414392..2414455 + 64 NuclAT_16 - -
- (2414392) 2414392..2414455 + 64 NuclAT_16 - -
- (2414392) 2414392..2414455 + 64 NuclAT_16 - -
- (2414392) 2414392..2414455 + 64 NuclAT_17 - -
- (2414392) 2414392..2414455 + 64 NuclAT_17 - -
- (2414392) 2414392..2414455 + 64 NuclAT_17 - -
- (2414392) 2414392..2414455 + 64 NuclAT_17 - -
- (2414392) 2414392..2414455 + 64 NuclAT_18 - -
- (2414392) 2414392..2414455 + 64 NuclAT_18 - -
- (2414392) 2414392..2414455 + 64 NuclAT_18 - -
- (2414392) 2414392..2414455 + 64 NuclAT_18 - -
- (2414392) 2414392..2414455 + 64 NuclAT_19 - -
- (2414392) 2414392..2414455 + 64 NuclAT_19 - -
- (2414392) 2414392..2414455 + 64 NuclAT_19 - -
- (2414392) 2414392..2414455 + 64 NuclAT_19 - -
- (2414390) 2414390..2414456 + 67 NuclAT_10 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_10 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_10 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_10 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_11 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_11 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_11 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_11 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_12 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_12 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_12 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_12 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_7 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_7 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_7 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_7 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_8 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_8 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_8 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_8 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_9 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_9 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_9 - Antitoxin
- (2414390) 2414390..2414456 + 67 NuclAT_9 - Antitoxin
- (2414392) 2414392..2414457 + 66 NuclAT_20 - -
- (2414392) 2414392..2414457 + 66 NuclAT_20 - -
- (2414392) 2414392..2414457 + 66 NuclAT_20 - -
- (2414392) 2414392..2414457 + 66 NuclAT_20 - -
- (2414392) 2414392..2414457 + 66 NuclAT_21 - -
- (2414392) 2414392..2414457 + 66 NuclAT_21 - -
- (2414392) 2414392..2414457 + 66 NuclAT_21 - -
- (2414392) 2414392..2414457 + 66 NuclAT_21 - -
- (2414392) 2414392..2414457 + 66 NuclAT_22 - -
- (2414392) 2414392..2414457 + 66 NuclAT_22 - -
- (2414392) 2414392..2414457 + 66 NuclAT_22 - -
- (2414392) 2414392..2414457 + 66 NuclAT_22 - -
- (2414392) 2414392..2414457 + 66 NuclAT_23 - -
- (2414392) 2414392..2414457 + 66 NuclAT_23 - -
- (2414392) 2414392..2414457 + 66 NuclAT_23 - -
- (2414392) 2414392..2414457 + 66 NuclAT_23 - -
- (2414392) 2414392..2414457 + 66 NuclAT_24 - -
- (2414392) 2414392..2414457 + 66 NuclAT_24 - -
- (2414392) 2414392..2414457 + 66 NuclAT_24 - -
- (2414392) 2414392..2414457 + 66 NuclAT_24 - -
- (2414392) 2414392..2414457 + 66 NuclAT_25 - -
- (2414392) 2414392..2414457 + 66 NuclAT_25 - -
- (2414392) 2414392..2414457 + 66 NuclAT_25 - -
- (2414392) 2414392..2414457 + 66 NuclAT_25 - -
QJP81_RS11905 (2414747) 2414747..2415847 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP81_RS11910 (2416117) 2416117..2416356 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP81_RS11915 (2416505) 2416505..2417200 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP81_RS11920 (2417244) 2417244..2417597 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP81_RS11925 (2417782) 2417782..2419176 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T279356 WP_001531632.1 NZ_CP124320:c2414342-2414235 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT279356 NZ_CP124320:2414390-2414456 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References