Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1591258..1591937 | Replicon | chromosome |
Accession | NZ_CP124320 | ||
Organism | Escherichia coli strain AVS0754 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP81_RS07670 | Protein ID | WP_000057523.1 |
Coordinates | 1591258..1591560 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP81_RS07675 | Protein ID | WP_000806442.1 |
Coordinates | 1591596..1591937 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP81_RS07645 (1586634) | 1586634..1588286 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QJP81_RS07650 (1588324) | 1588324..1588827 | - | 504 | WP_000667000.1 | hypothetical protein | - |
QJP81_RS07655 (1588824) | 1588824..1589624 | - | 801 | WP_000439798.1 | hypothetical protein | - |
QJP81_RS07660 (1589648) | 1589648..1590127 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP81_RS07665 (1590331) | 1590331..1591125 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP81_RS07670 (1591258) | 1591258..1591560 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP81_RS07675 (1591596) | 1591596..1591937 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP81_RS07680 (1591995) | 1591995..1594499 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP81_RS07685 (1594761) | 1594761..1595693 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T279355 WP_000057523.1 NZ_CP124320:1591258-1591560 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|