Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 253030..254348 | Replicon | chromosome |
Accession | NZ_CP124320 | ||
Organism | Escherichia coli strain AVS0754 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | QJP81_RS01190 | Protein ID | WP_001262467.1 |
Coordinates | 253341..254348 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | QJP81_RS01185 | Protein ID | WP_001312177.1 |
Coordinates | 253030..253341 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP81_RS01160 (248562) | 248562..249581 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
QJP81_RS01165 (249591) | 249591..250493 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
QJP81_RS01170 (250504) | 250504..251487 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
QJP81_RS01175 (251484) | 251484..252497 | + | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QJP81_RS01180 (252722) | 252722..253045 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
QJP81_RS01185 (253030) | 253030..253341 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
QJP81_RS01190 (253341) | 253341..254348 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
QJP81_RS01195 (254365) | 254365..255636 | - | 1272 | WP_001545666.1 | amino acid permease | - |
- (255998) | 255998..256063 | - | 66 | NuclAT_27 | - | - |
- (255998) | 255998..256063 | - | 66 | NuclAT_27 | - | - |
- (255998) | 255998..256063 | - | 66 | NuclAT_27 | - | - |
- (255998) | 255998..256063 | - | 66 | NuclAT_27 | - | - |
QJP81_RS01200 (256112) | 256112..256219 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (256481) | 256481..256538 | - | 58 | NuclAT_26 | - | - |
- (256481) | 256481..256538 | - | 58 | NuclAT_26 | - | - |
- (256481) | 256481..256538 | - | 58 | NuclAT_26 | - | - |
- (256481) | 256481..256538 | - | 58 | NuclAT_26 | - | - |
QJP81_RS01205 (256595) | 256595..256702 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP81_RS01210 (257078) | 257078..257185 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP81_RS01215 (257271) | 257271..258950 | - | 1680 | Protein_240 | cellulose biosynthesis protein BcsG | - |
QJP81_RS01220 (258947) | 258947..259138 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T279347 WP_001262467.1 NZ_CP124320:253341-254348 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |