279344

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4989683..4990269 Replicon chromosome
Accession NZ_CP124220
Organism Klebsiella pneumoniae strain Z

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QG930_RS24280 Protein ID WP_002920800.1
Coordinates 4989683..4990051 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QG930_RS24285 Protein ID WP_004174006.1
Coordinates 4990048..4990269 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QG930_RS24260 (QG930_24260) 4985186..4986256 - 1071 WP_017880090.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
QG930_RS24265 (QG930_24265) 4986258..4987103 - 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QG930_RS24270 (QG930_24270) 4987100..4987987 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QG930_RS24275 (QG930_24275) 4988094..4989410 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QG930_RS24280 (QG930_24280) 4989683..4990051 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QG930_RS24285 (QG930_24285) 4990048..4990269 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QG930_RS24290 (QG930_24290) 4990433..4991146 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QG930_RS24295 (QG930_24295) 4991148..4991915 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QG930_RS24300 (QG930_24300) 4991912..4993189 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QG930_RS24305 (QG930_24305) 4993186..4994112 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4984449..4993189 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T279344 WP_002920800.1 NZ_CP124220:c4990051-4989683 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT279344 WP_004174006.1 NZ_CP124220:c4990269-4990048 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References