Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4963436..4964082 | Replicon | chromosome |
Accession | NZ_CP124220 | ||
Organism | Klebsiella pneumoniae strain Z |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483PC41 |
Locus tag | QG930_RS24170 | Protein ID | WP_004216295.1 |
Coordinates | 4963735..4964082 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QG930_RS24165 | Protein ID | WP_002920557.1 |
Coordinates | 4963436..4963735 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG930_RS24145 (QG930_24145) | 4959642..4960400 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
QG930_RS24150 (QG930_24150) | 4960450..4961280 | - | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QG930_RS24155 (QG930_24155) | 4961331..4961660 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QG930_RS24160 (QG930_24160) | 4961865..4963373 | + | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
QG930_RS24165 (QG930_24165) | 4963436..4963735 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QG930_RS24170 (QG930_24170) | 4963735..4964082 | - | 348 | WP_004216295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG930_RS24175 (QG930_24175) | 4964258..4966705 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QG930_RS24180 (QG930_24180) | 4966723..4968156 | - | 1434 | WP_004889438.1 | glycogen synthase GlgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13606.61 Da Isoelectric Point: 5.6749
>T279343 WP_004216295.1 NZ_CP124220:c4964082-4963735 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCADNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCADNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483PC41 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |