Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1390546..1391143 | Replicon | chromosome |
| Accession | NZ_CP124220 | ||
| Organism | Klebsiella pneumoniae strain Z | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | QG930_RS06600 | Protein ID | WP_004893639.1 |
| Coordinates | 1390546..1390863 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | QG930_RS06605 | Protein ID | WP_004142561.1 |
| Coordinates | 1390856..1391143 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QG930_RS06585 (QG930_06585) | 1386250..1387677 | - | 1428 | WP_004176980.1 | MFS transporter | - |
| QG930_RS06590 (QG930_06590) | 1387786..1388652 | + | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| QG930_RS06595 (QG930_06595) | 1389318..1390361 | + | 1044 | WP_004893645.1 | DUF2157 domain-containing protein | - |
| QG930_RS06600 (QG930_06600) | 1390546..1390863 | + | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QG930_RS06605 (QG930_06605) | 1390856..1391143 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QG930_RS06610 (QG930_06610) | 1391408..1392061 | - | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| QG930_RS06615 (QG930_06615) | 1392181..1392549 | - | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| QG930_RS06620 (QG930_06620) | 1392549..1393130 | - | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| QG930_RS06625 (QG930_06625) | 1393310..1394425 | + | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| QG930_RS06630 (QG930_06630) | 1394456..1394797 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| QG930_RS06635 (QG930_06635) | 1394815..1395063 | - | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T279335 WP_004893639.1 NZ_CP124220:1390546-1390863 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|