Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 583648..584294 | Replicon | chromosome |
Accession | NZ_CP124220 | ||
Organism | Klebsiella pneumoniae strain Z |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QG930_RS02750 | Protein ID | WP_038808066.1 |
Coordinates | 583648..583998 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QG930_RS02755 | Protein ID | WP_038808067.1 |
Coordinates | 583995..584294 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG930_RS02725 (QG930_02725) | 579191..579418 | + | 228 | WP_071703920.1 | hypothetical protein | - |
QG930_RS02730 (QG930_02730) | 579411..580313 | + | 903 | WP_038808064.1 | integrase | - |
QG930_RS02735 (QG930_02735) | 580541..581809 | + | 1269 | WP_038808065.1 | tyrosine-type recombinase/integrase | - |
QG930_RS02740 (QG930_02740) | 581832..582017 | + | 186 | WP_071703921.1 | AlpA family phage regulatory protein | - |
QG930_RS02745 (QG930_02745) | 582101..583147 | + | 1047 | WP_071703922.1 | helicase RepA family protein | - |
QG930_RS02750 (QG930_02750) | 583648..583998 | + | 351 | WP_038808066.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG930_RS02755 (QG930_02755) | 583995..584294 | + | 300 | WP_038808067.1 | XRE family transcriptional regulator | Antitoxin |
QG930_RS02760 (QG930_02760) | 584803..585449 | + | 647 | WP_253612655.1 | IS1 family transposase | - |
QG930_RS02765 (QG930_02765) | 585610..586188 | + | 579 | WP_038808072.1 | hypothetical protein | - |
QG930_RS02770 (QG930_02770) | 586433..587692 | + | 1260 | WP_049006514.1 | integrase arm-type DNA-binding domain-containing protein | - |
QG930_RS02775 (QG930_02775) | 587940..588167 | + | 228 | WP_017880136.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 578559..618825 | 40266 | |
- | flank | IS/Tn | - | - | 585072..585449 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13662.61 Da Isoelectric Point: 6.9801
>T279331 WP_038808066.1 NZ_CP124220:583648-583998 [Klebsiella pneumoniae]
MWTVLFSQRFDDWLSEQDDALQEKVLADLGKLQVYGPELPRPYADTLKGSRYKNMKELRIQFSGQPIRAFYAFDPIRRAI
VLCAGYKSNDKRFYEKLIRIAEDEFAAHLQNLEINQ
MWTVLFSQRFDDWLSEQDDALQEKVLADLGKLQVYGPELPRPYADTLKGSRYKNMKELRIQFSGQPIRAFYAFDPIRRAI
VLCAGYKSNDKRFYEKLIRIAEDEFAAHLQNLEINQ
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|