Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1299146..1299801 | Replicon | chromosome |
Accession | NZ_CP124219 | ||
Organism | Pseudomonas sp. P13 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QFW95_RS05745 | Protein ID | WP_274089993.1 |
Coordinates | 1299146..1299490 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QFW95_RS05750 | Protein ID | WP_274089992.1 |
Coordinates | 1299487..1299801 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW95_RS05720 | 1294161..1295108 | + | 948 | WP_047228600.1 | ubiquinol oxidase subunit II | - |
QFW95_RS05725 | 1295112..1297142 | + | 2031 | WP_047228599.1 | cytochrome o ubiquinol oxidase subunit I | - |
QFW95_RS05730 | 1297146..1297772 | + | 627 | WP_047228598.1 | cytochrome o ubiquinol oxidase subunit III | - |
QFW95_RS05735 | 1297773..1298108 | + | 336 | WP_025211927.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QFW95_RS05740 | 1298120..1299007 | + | 888 | WP_047228597.1 | heme o synthase | - |
QFW95_RS05745 | 1299146..1299490 | + | 345 | WP_274089993.1 | toxin | Toxin |
QFW95_RS05750 | 1299487..1299801 | + | 315 | WP_274089992.1 | helix-turn-helix domain-containing protein | Antitoxin |
QFW95_RS05755 | 1300145..1300849 | - | 705 | WP_092456206.1 | hypothetical protein | - |
QFW95_RS05760 | 1300988..1302001 | - | 1014 | WP_047228595.1 | diguanylate cyclase | - |
QFW95_RS05765 | 1302193..1303110 | - | 918 | WP_047228594.1 | LysR family transcriptional regulator | - |
QFW95_RS05770 | 1303209..1304384 | + | 1176 | WP_076386553.1 | aspartate aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13608.65 Da Isoelectric Point: 9.6385
>T279328 WP_274089993.1 NZ_CP124219:1299146-1299490 [Pseudomonas sp. P13]
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLEHPEVGDVMPRTGGFRKLRWFDGRRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELVNLTSEQEKTLKRAIEAELKVRGTL
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLEHPEVGDVMPRTGGFRKLRWFDGRRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELVNLTSEQEKTLKRAIEAELKVRGTL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|