Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 16109..16760 Replicon plasmid pAb4294
Accession NZ_CP123992
Organism Acinetobacter baumannii strain Ab4294

Toxin (Protein)


Gene name higB Uniprot ID S3SZA7
Locus tag QE150_RS00085 Protein ID WP_000269903.1
Coordinates 16109..16465 (+) Length 119 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QE150_RS00090 Protein ID WP_001140619.1
Coordinates 16458..16760 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE150_RS00050 (QE150_00050) 11365..11748 - 384 WP_281309336.1 hypothetical protein -
QE150_RS00055 (QE150_00055) 11948..12250 + 303 WP_000286963.1 type II toxin-antitoxin system RelE/ParE family toxin -
QE150_RS00060 (QE150_00060) 12251..12532 + 282 WP_000985610.1 putative addiction module antidote protein -
QE150_RS00065 (QE150_00065) 12760..13693 + 934 Protein_12 IS5-like element ISAba13 family transposase -
QE150_RS00070 (QE150_00070) 13757..14128 - 372 WP_009501156.1 RcnB family protein -
QE150_RS00075 (QE150_00075) 14465..14695 + 231 WP_009501150.1 hypothetical protein -
QE150_RS00080 (QE150_00080) 14865..15401 - 537 WP_009501148.1 porin family protein -
QE150_RS00085 (QE150_00085) 16109..16465 + 357 WP_000269903.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE150_RS00090 (QE150_00090) 16458..16760 + 303 WP_001140619.1 XRE family transcriptional regulator Antitoxin
QE150_RS00095 (QE150_00095) 16753..16962 + 210 WP_000069471.1 hypothetical protein -
QE150_RS00100 (QE150_00100) 17087..17299 - 213 WP_016653394.1 hypothetical protein -
QE150_RS00105 (QE150_00105) 17752..19356 - 1605 WP_130120076.1 IS66 family transposase -
QE150_RS00110 (QE150_00110) 19426..19761 - 336 WP_004691519.1 IS66 family insertion sequence element accessory protein TnpB -
QE150_RS00115 (QE150_00115) 19758..20141 - 384 WP_004762545.1 transposase -
QE150_RS00120 (QE150_00120) 20348..20893 - 546 Protein_23 IS5 family transposase -
QE150_RS00125 (QE150_00125) 20821..21027 - 207 WP_235824376.1 AAA family ATPase -
QE150_RS00130 (QE150_00130) 21081..21209 - 129 WP_002123981.1 AAA family ATPase -
QE150_RS00135 (QE150_00135) 21397..21717 + 321 WP_004704395.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..154924 154924
- inside IScluster/Tn - - 5266..20830 15564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

HigA2-like, helix-turn-helix domain

(13-89)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13486.45 Da        Isoelectric Point: 7.1645

>T279310 WP_000269903.1 NZ_CP123992:16109-16465 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG

Download         Length: 357 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11206.01 Da        Isoelectric Point: 6.7282

>AT279310 WP_001140619.1 NZ_CP123992:16458-16760 [Acinetobacter baumannii]
MAKTLQELLANRSPESQARIQQMADELLLETQLHLIREELEISQKELAATLGIKQPSLSAIENRGHDLKISTMKKYVEAM
GGKLRIDVELPTGKHIGFNV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A836MG83

Antitoxin

Source ID Structure

References