Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 16109..16760 | Replicon | plasmid pAb4294 |
Accession | NZ_CP123992 | ||
Organism | Acinetobacter baumannii strain Ab4294 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S3SZA7 |
Locus tag | QE150_RS00085 | Protein ID | WP_000269903.1 |
Coordinates | 16109..16465 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QE150_RS00090 | Protein ID | WP_001140619.1 |
Coordinates | 16458..16760 (+) | Length | 101 a.a. |
Genomic Context
Location: 11948..12250 (303 bp)
Type: Others
Protein ID: WP_000286963.1
Type: Others
Protein ID: WP_000286963.1
Location: 12251..12532 (282 bp)
Type: Others
Protein ID: WP_000985610.1
Type: Others
Protein ID: WP_000985610.1
Location: 12760..13693 (934 bp)
Type: Others
Protein ID: Protein_12
Type: Others
Protein ID: Protein_12
Location: 14465..14695 (231 bp)
Type: Others
Protein ID: WP_009501150.1
Type: Others
Protein ID: WP_009501150.1
Location: 16109..16465 (357 bp)
Type: Toxin
Protein ID: WP_000269903.1
Type: Toxin
Protein ID: WP_000269903.1
Location: 16458..16760 (303 bp)
Type: Antitoxin
Protein ID: WP_001140619.1
Type: Antitoxin
Protein ID: WP_001140619.1
Location: 16753..16962 (210 bp)
Type: Others
Protein ID: WP_000069471.1
Type: Others
Protein ID: WP_000069471.1
Location: 21397..21717 (321 bp)
Type: Others
Protein ID: WP_004704395.1
Type: Others
Protein ID: WP_004704395.1
Location: 11365..11748 (384 bp)
Type: Others
Protein ID: WP_281309336.1
Type: Others
Protein ID: WP_281309336.1
Location: 13757..14128 (372 bp)
Type: Others
Protein ID: WP_009501156.1
Type: Others
Protein ID: WP_009501156.1
Location: 14865..15401 (537 bp)
Type: Others
Protein ID: WP_009501148.1
Type: Others
Protein ID: WP_009501148.1
Location: 17087..17299 (213 bp)
Type: Others
Protein ID: WP_016653394.1
Type: Others
Protein ID: WP_016653394.1
Location: 17752..19356 (1605 bp)
Type: Others
Protein ID: WP_130120076.1
Type: Others
Protein ID: WP_130120076.1
Location: 19426..19761 (336 bp)
Type: Others
Protein ID: WP_004691519.1
Type: Others
Protein ID: WP_004691519.1
Location: 19758..20141 (384 bp)
Type: Others
Protein ID: WP_004762545.1
Type: Others
Protein ID: WP_004762545.1
Location: 20348..20893 (546 bp)
Type: Others
Protein ID: Protein_23
Type: Others
Protein ID: Protein_23
Location: 20821..21027 (207 bp)
Type: Others
Protein ID: WP_235824376.1
Type: Others
Protein ID: WP_235824376.1
Location: 21081..21209 (129 bp)
Type: Others
Protein ID: WP_002123981.1
Type: Others
Protein ID: WP_002123981.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE150_RS00050 (QE150_00050) | 11365..11748 | - | 384 | WP_281309336.1 | hypothetical protein | - |
QE150_RS00055 (QE150_00055) | 11948..12250 | + | 303 | WP_000286963.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QE150_RS00060 (QE150_00060) | 12251..12532 | + | 282 | WP_000985610.1 | putative addiction module antidote protein | - |
QE150_RS00065 (QE150_00065) | 12760..13693 | + | 934 | Protein_12 | IS5-like element ISAba13 family transposase | - |
QE150_RS00070 (QE150_00070) | 13757..14128 | - | 372 | WP_009501156.1 | RcnB family protein | - |
QE150_RS00075 (QE150_00075) | 14465..14695 | + | 231 | WP_009501150.1 | hypothetical protein | - |
QE150_RS00080 (QE150_00080) | 14865..15401 | - | 537 | WP_009501148.1 | porin family protein | - |
QE150_RS00085 (QE150_00085) | 16109..16465 | + | 357 | WP_000269903.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QE150_RS00090 (QE150_00090) | 16458..16760 | + | 303 | WP_001140619.1 | XRE family transcriptional regulator | Antitoxin |
QE150_RS00095 (QE150_00095) | 16753..16962 | + | 210 | WP_000069471.1 | hypothetical protein | - |
QE150_RS00100 (QE150_00100) | 17087..17299 | - | 213 | WP_016653394.1 | hypothetical protein | - |
QE150_RS00105 (QE150_00105) | 17752..19356 | - | 1605 | WP_130120076.1 | IS66 family transposase | - |
QE150_RS00110 (QE150_00110) | 19426..19761 | - | 336 | WP_004691519.1 | IS66 family insertion sequence element accessory protein TnpB | - |
QE150_RS00115 (QE150_00115) | 19758..20141 | - | 384 | WP_004762545.1 | transposase | - |
QE150_RS00120 (QE150_00120) | 20348..20893 | - | 546 | Protein_23 | IS5 family transposase | - |
QE150_RS00125 (QE150_00125) | 20821..21027 | - | 207 | WP_235824376.1 | AAA family ATPase | - |
QE150_RS00130 (QE150_00130) | 21081..21209 | - | 129 | WP_002123981.1 | AAA family ATPase | - |
QE150_RS00135 (QE150_00135) | 21397..21717 | + | 321 | WP_004704395.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..154924 | 154924 | |
- | inside | IScluster/Tn | - | - | 5266..20830 | 15564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13486.45 Da Isoelectric Point: 7.1645
>T279310 WP_000269903.1 NZ_CP123992:16109-16465 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836MG83 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |