Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-sprA1AS/-
Location 2420144..2420292 Replicon chromosome
Accession NZ_CP123983
Organism Staphylococcus haemolyticus strain SH9361

Toxin (Protein)


Gene name SprA2 Uniprot ID -
Locus tag QHG39_RS11905 Protein ID WP_011276848.1
Coordinates 2420144..2420239 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2420257..2420292 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QHG39_RS11870 (QHG39_11870) 2415869..2416102 + 234 WP_016931184.1 hypothetical protein -
QHG39_RS11875 (QHG39_11875) 2416210..2416527 - 318 Protein_2290 IS200/IS605-like element ISSep3 family transposase -
QHG39_RS11880 (QHG39_11880) 2417352..2417477 + 126 WP_031886468.1 hypothetical protein -
QHG39_RS11885 (QHG39_11885) 2418082..2418612 + 531 WP_011276845.1 N-acetyltransferase -
QHG39_RS11890 (QHG39_11890) 2418852..2419235 + 384 WP_011276846.1 effector binding domain-containing protein -
QHG39_RS11895 (QHG39_11895) 2419374..2419550 + 177 WP_281132971.1 hypothetical protein -
QHG39_RS11900 (QHG39_11900) 2419803..2419949 + 147 WP_000668388.1 hypothetical protein -
QHG39_RS11905 (QHG39_11905) 2420144..2420239 + 96 WP_011276848.1 type I toxin-antitoxin system Fst family toxin Toxin
- 2420257..2420292 + 36 - - Antitoxin
QHG39_RS11910 (QHG39_11910) 2420433..2421092 + 660 WP_193626752.1 nucleotidyltransferase -
QHG39_RS11915 (QHG39_11915) 2421338..2421940 + 603 WP_011276850.1 hypothetical protein -
QHG39_RS11920 (QHG39_11920) 2422299..2423144 - 846 WP_002440508.1 penicillin-hydrolyzing class A beta-lactamase BlaZ -
QHG39_RS11925 (QHG39_11925) 2423251..2425008 + 1758 WP_032604370.1 beta-lactam sensor/signal transducer BlaR1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaZ / aac(6')-aph(2'') - 2416207..2436612 20405
- flank IS/Tn - - 2416207..2416527 320


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3623.38 Da        Isoelectric Point: 9.5124

>T279306 WP_011276848.1 NZ_CP123983:2420144-2420239 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK

Download         Length: 96 bp

Antitoxin


Download         Length: 36 bp

>AT279306 NZ_CP123983:2420257-2420292 [Staphylococcus haemolyticus]
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References