Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 504034..504259 | Replicon | chromosome |
Accession | NZ_CP123966 | ||
Organism | Lysinibacillus sp. |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | QH639_RS02700 | Protein ID | WP_281115638.1 |
Coordinates | 504104..504259 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 504034..504092 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QH639_RS02675 (499579) | 499579..500178 | + | 600 | WP_281115636.1 | Ail/Lom family outer membrane beta-barrel protein | - |
QH639_RS02680 (500243) | 500243..500548 | + | 306 | WP_281115637.1 | DUF977 family protein | - |
QH639_RS02685 (500872) | 500872..501111 | + | 240 | WP_001367360.1 | hypothetical protein | - |
QH639_RS02690 (501114) | 501114..501710 | + | 597 | WP_032286199.1 | hypothetical protein | - |
QH639_RS02695 (501934) | 501934..503658 | + | 1725 | WP_000479014.1 | DUF2326 domain-containing protein | - |
- (504034) | 504034..504092 | - | 59 | NuclAT_0 | - | Antitoxin |
- (504034) | 504034..504092 | - | 59 | NuclAT_0 | - | Antitoxin |
QH639_RS02700 (504104) | 504104..504259 | + | 156 | WP_281115638.1 | Hok/Gef family protein | Toxin |
QH639_RS02705 (504780) | 504780..506081 | - | 1302 | WP_131522313.1 | NCS2 family permease | - |
QH639_RS02710 (506524) | 506524..507192 | - | 669 | WP_237898753.1 | MOSC domain-containing protein | - |
QH639_RS02715 (507367) | 507367..508920 | - | 1554 | WP_131522315.1 | glutamine-hydrolyzing GMP synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5731.00 Da Isoelectric Point: 10.1323
>T279289 WP_281115638.1 NZ_CP123966:504104-504259 [Lysinibacillus sp. 1 U-2021]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEGLPTCYSPVRR
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEGLPTCYSPVRR
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT279289 NZ_CP123966:c504092-504034 [Lysinibacillus sp. 1 U-2021]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|