Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3644037..3644731 | Replicon | chromosome |
Accession | NZ_CP123963 | ||
Organism | Escherichia coli strain L6-21 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | QC817_RS17930 | Protein ID | WP_001263493.1 |
Coordinates | 3644037..3644435 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | QC817_RS17935 | Protein ID | WP_000554757.1 |
Coordinates | 3644438..3644731 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3639697) | 3639697..3639777 | - | 81 | NuclAT_9 | - | - |
- (3639697) | 3639697..3639777 | - | 81 | NuclAT_9 | - | - |
- (3639697) | 3639697..3639777 | - | 81 | NuclAT_9 | - | - |
- (3639697) | 3639697..3639777 | - | 81 | NuclAT_9 | - | - |
QC817_RS17900 (3639037) | 3639037..3640281 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
QC817_RS17905 (3640373) | 3640373..3640831 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QC817_RS17910 (3641092) | 3641092..3642549 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
QC817_RS17915 (3642606) | 3642606..3643127 | - | 522 | Protein_3502 | peptide chain release factor H | - |
QC817_RS17920 (3643126) | 3643126..3643329 | - | 204 | Protein_3503 | RtcB family protein | - |
QC817_RS17925 (3643575) | 3643575..3644027 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
QC817_RS17930 (3644037) | 3644037..3644435 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QC817_RS17935 (3644438) | 3644438..3644731 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QC817_RS17940 (3644783) | 3644783..3645838 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QC817_RS17945 (3645909) | 3645909..3646694 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
QC817_RS17950 (3646666) | 3646666..3648378 | + | 1713 | Protein_3509 | flagellar biosynthesis protein FlhA | - |
QC817_RS17955 (3648602) | 3648602..3649099 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3643075..3659316 | 16241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T279286 WP_001263493.1 NZ_CP123963:c3644435-3644037 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|