Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3644037..3644731 Replicon chromosome
Accession NZ_CP123963
Organism Escherichia coli strain L6-21

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QC817_RS17930 Protein ID WP_001263493.1
Coordinates 3644037..3644435 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QC817_RS17935 Protein ID WP_000554757.1
Coordinates 3644438..3644731 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3639697) 3639697..3639777 - 81 NuclAT_9 - -
- (3639697) 3639697..3639777 - 81 NuclAT_9 - -
- (3639697) 3639697..3639777 - 81 NuclAT_9 - -
- (3639697) 3639697..3639777 - 81 NuclAT_9 - -
QC817_RS17900 (3639037) 3639037..3640281 - 1245 WP_000189541.1 esterase FrsA -
QC817_RS17905 (3640373) 3640373..3640831 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QC817_RS17910 (3641092) 3641092..3642549 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QC817_RS17915 (3642606) 3642606..3643127 - 522 Protein_3502 peptide chain release factor H -
QC817_RS17920 (3643126) 3643126..3643329 - 204 Protein_3503 RtcB family protein -
QC817_RS17925 (3643575) 3643575..3644027 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QC817_RS17930 (3644037) 3644037..3644435 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QC817_RS17935 (3644438) 3644438..3644731 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QC817_RS17940 (3644783) 3644783..3645838 - 1056 WP_001226164.1 DNA polymerase IV -
QC817_RS17945 (3645909) 3645909..3646694 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
QC817_RS17950 (3646666) 3646666..3648378 + 1713 Protein_3509 flagellar biosynthesis protein FlhA -
QC817_RS17955 (3648602) 3648602..3649099 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3643075..3659316 16241


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T279286 WP_001263493.1 NZ_CP123963:c3644435-3644037 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT279286 WP_000554757.1 NZ_CP123963:c3644731-3644438 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References