Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 717821..718514 | Replicon | chromosome |
Accession | NZ_CP123963 | ||
Organism | Escherichia coli strain L6-21 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QC817_RS03530 | Protein ID | WP_000415584.1 |
Coordinates | 717821..718117 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QC817_RS03535 | Protein ID | WP_000650107.1 |
Coordinates | 718119..718514 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC817_RS03495 (712909) | 712909..713223 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QC817_RS03500 (713254) | 713254..713835 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QC817_RS03505 (714154) | 714154..714486 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QC817_RS03510 (714532) | 714532..715881 | - | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
QC817_RS03515 (715878) | 715878..716537 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QC817_RS03520 (716689) | 716689..717081 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QC817_RS03525 (717134) | 717134..717616 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QC817_RS03530 (717821) | 717821..718117 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QC817_RS03535 (718119) | 718119..718514 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QC817_RS03540 (718647) | 718647..720254 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QC817_RS03545 (720392) | 720392..722650 | + | 2259 | WP_032161229.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T279271 WP_000415584.1 NZ_CP123963:717821-718117 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT279271 WP_000650107.1 NZ_CP123963:718119-718514 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|