Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 653896..654623 | Replicon | chromosome |
| Accession | NZ_CP123963 | ||
| Organism | Escherichia coli strain L6-21 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | QC817_RS03220 | Protein ID | WP_000550189.1 |
| Coordinates | 653896..654210 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QC817_RS03225 | Protein ID | WP_000560266.1 |
| Coordinates | 654207..654623 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC817_RS03200 (650063) | 650063..651049 | - | 987 | WP_023281494.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QC817_RS03205 (651128) | 651128..651811 | - | 684 | WP_032161233.1 | vancomycin high temperature exclusion protein | - |
| QC817_RS03210 (651888) | 651888..652391 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| QC817_RS03215 (652476) | 652476..653612 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| QC817_RS03220 (653896) | 653896..654210 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QC817_RS03225 (654207) | 654207..654623 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QC817_RS03230 (654668) | 654668..656686 | - | 2019 | WP_023281493.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| QC817_RS03235 (657112) | 657112..659463 | - | 2352 | WP_024238710.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T279270 WP_000550189.1 NZ_CP123963:653896-654210 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT279270 WP_000560266.1 NZ_CP123963:654207-654623 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|