Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6227564..6228159 | Replicon | chromosome |
| Accession | NZ_CP123953 | ||
| Organism | Pseudomonas aeruginosa strain 59 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | P4N66_RS30105 | Protein ID | WP_003113526.1 |
| Coordinates | 6227881..6228159 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P4N66_RS30100 | Protein ID | WP_003099268.1 |
| Coordinates | 6227564..6227869 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4N66_RS30065 (P4N66_gene5950) | 6222704..6223552 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| P4N66_RS30075 | 6223719..6224660 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| P4N66_RS30080 (P4N66_gene5952) | 6224777..6225391 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| P4N66_RS30085 (P4N66_gene5953) | 6225433..6226017 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| P4N66_RS30090 (P4N66_gene5954) | 6226058..6227158 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| P4N66_RS30100 (P4N66_gene5956) | 6227564..6227869 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| P4N66_RS30105 | 6227881..6228159 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P4N66_RS30110 | 6228221..6228340 | - | 120 | Protein_5959 | integrase | - |
| P4N66_RS30115 (P4N66_gene5957) | 6228488..6230716 | + | 2229 | WP_281118942.1 | TonB-dependent receptor | - |
| P4N66_RS30120 (P4N66_gene5958) | 6230786..6231433 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| P4N66_RS30125 (P4N66_gene5959) | 6231495..6232733 | - | 1239 | WP_019681675.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T279253 WP_003113526.1 NZ_CP123953:c6228159-6227881 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|