Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1987987..1988680 | Replicon | chromosome |
Accession | NZ_CP123951 | ||
Organism | Escherichia coli strain TL012 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QGM68_RS09550 | Protein ID | WP_000415584.1 |
Coordinates | 1987987..1988283 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QGM68_RS09555 | Protein ID | WP_000650107.1 |
Coordinates | 1988285..1988680 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGM68_RS09515 (1983075) | 1983075..1983389 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QGM68_RS09520 (1983420) | 1983420..1984001 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QGM68_RS09525 (1984320) | 1984320..1984652 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QGM68_RS09530 (1984698) | 1984698..1986047 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QGM68_RS09535 (1986044) | 1986044..1986703 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QGM68_RS09540 (1986855) | 1986855..1987247 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QGM68_RS09545 (1987300) | 1987300..1987782 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QGM68_RS09550 (1987987) | 1987987..1988283 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QGM68_RS09555 (1988285) | 1988285..1988680 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QGM68_RS09560 (1988813) | 1988813..1990420 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QGM68_RS09565 (1990558) | 1990558..1992816 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T279232 WP_000415584.1 NZ_CP123951:1987987-1988283 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT279232 WP_000650107.1 NZ_CP123951:1988285-1988680 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|