Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1924444..1925171 | Replicon | chromosome |
| Accession | NZ_CP123951 | ||
| Organism | Escherichia coli strain TL012 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | QGM68_RS09245 | Protein ID | WP_000550189.1 |
| Coordinates | 1924444..1924758 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QGM68_RS09250 | Protein ID | WP_000560266.1 |
| Coordinates | 1924755..1925171 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QGM68_RS09225 (1920602) | 1920602..1921588 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QGM68_RS09230 (1921667) | 1921667..1922359 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
| QGM68_RS09235 (1922436) | 1922436..1922939 | - | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
| QGM68_RS09240 (1923024) | 1923024..1924160 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| QGM68_RS09245 (1924444) | 1924444..1924758 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QGM68_RS09250 (1924755) | 1924755..1925171 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QGM68_RS09255 (1925216) | 1925216..1927234 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| QGM68_RS09260 (1927660) | 1927660..1930011 | - | 2352 | WP_000695486.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T279231 WP_000550189.1 NZ_CP123951:1924444-1924758 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT279231 WP_000560266.1 NZ_CP123951:1924755-1925171 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|